KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394148Help
Entry
100394148         CDS       T03264                                 

Gene name
TNFRSF1B
Definition
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100394148 (TNFRSF1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100394148 (TNFRSF1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100394148 (TNFRSF1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100394148 (TNFRSF1B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100394148 (TNFRSF1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100394148 (TNFRSF1B)
   04090 CD molecules [BR:cjc04090]
    100394148 (TNFRSF1B)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100394148 (TNFRSF1B)
CD molecules [BR:cjc04090]
 Proteins
  100394148 (TNFRSF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 100394148
NCBI-ProteinID: XP_017829823
Ensembl: ENSCJAG00000013571
Position
7
AA seq 442 aa AA seqDB search
MPVKLEVTFTPYTPKPGSTCQINEYYHQTAQRCCSQCPAGQHAKVFCTRTSDTVCDFCEN
STYTELWNWLPECLSCGSPCSSDQVETQACTQQQNRICACMPGWYCALGKQEGCRLCSPL
RKCGPGFGVAKPGTERSDVVCKPCAPGTFSSTTSSTDICRPHQRCNLVAFPGNASMDAVC
LSESLAQSTAPDPAYPPQPVSTQSPNMKPSPGPSTAPSTSFLLPDGPSPPAKGSTGDISX
XLGPIVGVTVLGLLIIGVVNCVIMTQVKKKPSCLQREAKVPHLPSDKARGAQGPEQQHLL
TTAPSSSSSSLESSASASDRRVPTQNQPEAEGVGKASGAGEFRASTGSSDSPPGGHGTQV
NVTCIVNVCSGSDHSSQCSSQASTTTGYTDASPSGSPKDEKVPFSKEECAFQSRLETPET
LLQNTGEKPLPLGVPDAGMKSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaagctagaggtgacatttacaccctacaccccaaagcccgggagcacgtgc
cagatcaacgaatactatcaccagacagctcagaggtgctgcagccagtgtccagcgggc
caacatgcaaaagtcttctgtaccaggacttcagacactgtgtgtgacttctgtgagaac
agcacatacactgagctctggaactggcttcctgagtgcttgagctgcggctctccctgt
agctctgaccaggtggaaactcaagcctgcactcagcaacaaaaccgcatctgcgcctgc
atgcccggctggtactgcgcgctgggcaagcaggaggggtgccggctgtgctcgccgctg
cgcaagtgtggcccgggcttcggcgtagccaaaccaggaactgaaagatcagacgtggtg
tgcaagccgtgtgccccaggaacgttctccagcacgacttcatccacagatatttgcagg
ccccaccagagatgtaacctggtggccttccctgggaatgcaagcatggatgcagtctgc
ctgtcggagtccctcgcccagagcacggccccagacccagcatacccaccgcagccagtg
tccacacaatccccgaacatgaagccatctccagggcccagtacggctccaagcacctcc
ttcctgctgccagatggccccagccccccagctaaagggagcactggcgacatctcnnnn
nttctaggaccgatcgtgggtgtgacagtcttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagccctcctgcctgcagagagaagccaaggtg
cctcacctgccttctgataaggcccggggtgcccagggccctgagcagcagcacctgctg
accacagcgccgagctccagcagcagttccctggagagctcagccagtgcttcggacagg
agggtgcctacccaaaaccagccagaggcagaaggcgtggggaaggccagcggagccggg
gagttccgggccagcaccgggagctcagattctccccctgggggccatgggacccaggtc
aatgtcacctgcatcgtgaacgtctgtagcggttccgaccacagctcacagtgctcctcc
caggccagcaccacaacggggtacacagatgccagcccctcgggctccccaaaggatgag
aaggtccccttctccaaggaagagtgcgcctttcagtctcggctggagacaccagagacc
ctgctgcagaacaccggagagaagcccctgccccttggcgtgcccgatgcggggatgaag
tccagttaa

DBGET integrated database retrieval system