KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394168Help
Entry
100394168         CDS       T03264                                 

Gene name
PTGER2
Definition
(RefSeq) prostaglandin E receptor 2
  KO
K04259  prostaglandin E receptor 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04924  Renin secretion
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100394168 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100394168 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100394168 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100394168 (PTGER2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394168 (PTGER2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100394168 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100394168 (PTGER2)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100394168 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100394168
NCBI-ProteinID: XP_017832600
Position
10
AA seq 357 aa AA seqDB search
MGNASNDSWPEDCGTRQWLPPGESPAISSAMFSAGVLGNLIALALLARRWRGDTGCSAGR
RCSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMAQERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLLCSLPLLDYGQYVQ
YCPGTWCFIRHDQTSYLQLYATLLLLLIVAVLACNFSVILNLIRMHRRSXRSRCGPSWAV
AGAAPGPXERERVSMTEETDHXILLAIMTIXFAVCSFPFTIFAYMNETSSRKEKWDLQAL
RFLSINSIIDPWVFAILRPPVLRLIRSVLCCRISLRTQDATQTSCSTQSDASKQADL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcctggcccgaggactgcgggacgcgacagtggcttccc
ccgggcgaaagcccagctatcagctccgcgatgttctcggccggggtgctggggaacctc
atcgcgctggcgctgctggcgcgccgctggcggggggacacggggtgcagcgctggccgc
agatgctccctctccttattccacgtgctggtgaccgagctggtgttcaccgacctgctc
gggacttgcctcataagcccggtggtattggcttcgtacgcacggaaccagaccctggta
gcactggcacccgagagccgtgcgtgcacctacttcgcttttgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggcccaggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgtgtctcgcgctcagggggcctggccgtgctgcccgtcatc
tacgcagtctccctgctcttatgctcgctgccgctgctggactacgggcagtacgtccag
tactgccccgggacctggtgcttcatccggcacgaccagacctcttacctgcagctgtac
gccaccctgctgttgctcctcatcgtcgcggtgctcgcctgcaacttcagtgtcatcctc
aacctcattcgcatgcaccgccgaagcnagagaagccgctgtggaccttcttgggcagtg
gccggtgcggccccgggcccgtaggagagggaaagggtgtccatgacagaggagacggac
cacntcattctcctggctatcatgactatcnacttcgccgtctgctcctttcctttcacg
atttttgcatatatgaatgaaacctcttcacgaaaggaaaagtgggacctccaagctctt
agatttttatcaattaattcaataattgacccttgggtctttgccatccttaggcctcct
gttctgagactgatacgttcagtcctttgttgtcggatttcattaagaacacaagatgca
acgcaaacttcctgttctacacagtcagatgccagtaaacaggctgacctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410649Help
Entry
100410649         CDS       T03264                                 

Gene name
PTGER4
Definition
(RefSeq) prostaglandin E receptor 4
  KO
K04261  prostaglandin E receptor 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04924  Renin secretion
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100410649 (PTGER4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100410649 (PTGER4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100410649 (PTGER4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410649 (PTGER4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100410649 (PTGER4)
   05165 Human papillomavirus infection
    100410649 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100410649 (PTGER4)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100410649 (PTGER4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL PKS_DE
Motif
Other DBs
NCBI-GeneID: 100410649
NCBI-ProteinID: XP_002745074
Ensembl: ENSCJAG00000007410
UniProt: F6VDJ8
Position
2
AA seq 490 aa AA seqDB search
MSTPGVNASASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGRPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYVSNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHGAAAAVTSVAS
RGHPAASPVLPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQLY
QPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRREH
SGQHCSDSRRTSSAMSGHSRSFLSRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGV
PGIGLSQEDTTSLRTLRISETSDSSQGQDSESVLLVDKVGGSSRAGPVPKESSLQVTFPS
ETLNLSEKCI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcctggggtcaatgcgtctgcctccttgagccccgaccggctgaacagccca
gtgaccatcccggcggtgatgttcatcttcggggtggtgggcaacctggtggccatcgta
gtgttgtgcaagtcgcgcaaggagcagaaggagacgaccttctacacgctggtatgtggg
ctggctgtcaccgacctgttgggcactttgctggtgagcccggtgaccatcgccacgtac
atgaaaggccagtggcccggcggccggccgctgtgcgagtacagcaccttcattctgctc
ttcttcagcttgtccggcctcagcatcatctgcgccatgagtgtcgagcgctacctggcc
atcaaccacgcctatttctacagccactacgtggacaagcggttggccggcctcacgctc
tttgcggtctatgtgtccaacgtgctcttctgcgcgctgcccaacatgggcctcggtagc
tcgcggctgcagtacccagacacctggtgcttcatcgactggaccaccaatgtgacggca
cacgccgcctactcctacatgtacgcgggcttcagctccttcctcattctcgccactgtc
ctctgcaacgtgctggtgtgcggcgcactgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcaccgagcagcaccacggggccgcggccgccgtgacctcggttgcctcc
cggggccaccccgcggcctctccagtcttgccgcgcctcagcgactttcgccgccgccgg
agcttccgccgtatcgcgggcgcggagatccagatggtcatcttactcatcgccacttcc
ctggtggtgctcatctgctccatcccgctcgtggtgcgagtattcatcaaccagttgtat
cagccaagtttggagcgagaagtcagtaaaaatccagatttgcaggccatccgaattgct
tctgtgaaccccatcctggacccctggatatatatcctcctgagaaagacagtgctcagt
aaagcaatagagaagatcaaatgcctcttctgccgcattggcgggtcccgcagagagcac
tctggacagcactgctcagacagtcgaaggacatcttctgccatgtcaggccactctcgc
tccttcctctcccgggagctgaaggagatcagcagcacatctcagaccctcctgccagac
ctctcactgccagacctcagtgaaaatggccttggaggcaggaatttgcttccaggtgtg
cccggcatcggcctttcccaggaagataccacctcactgaggactttgcgaatatcagag
acctcagactcttcacagggtcaggactcagagagtgtcttactggtggataaggttggt
gggagcagcagggctgggcctgtccctaaggagagctccctgcaagtcacatttcccagt
gaaacactgaacttatcagaaaaatgtatataa

DBGET integrated database retrieval system