KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394399Help
Entry
100394399         CDS       T03264                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100394399 (GADD45A)
   04068 FoxO signaling pathway
    100394399 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100394399 (GADD45A)
   04210 Apoptosis
    100394399 (GADD45A)
   04115 p53 signaling pathway
    100394399 (GADD45A)
   04218 Cellular senescence
    100394399 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394399 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100394399 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100394399 (GADD45A)
   05212 Pancreatic cancer
    100394399 (GADD45A)
   05225 Hepatocellular carcinoma
    100394399 (GADD45A)
   05226 Gastric cancer
    100394399 (GADD45A)
   05214 Glioma
    100394399 (GADD45A)
   05216 Thyroid cancer
    100394399 (GADD45A)
   05220 Chronic myeloid leukemia
    100394399 (GADD45A)
   05217 Basal cell carcinoma
    100394399 (GADD45A)
   05218 Melanoma
    100394399 (GADD45A)
   05213 Endometrial cancer
    100394399 (GADD45A)
   05224 Breast cancer
    100394399 (GADD45A)
   05222 Small cell lung cancer
    100394399 (GADD45A)
   05223 Non-small cell lung cancer
    100394399 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100394399 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100394399 (GADD45A)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100394399 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100394399 (GADD45A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae XPA_C
Motif
Other DBs
NCBI-GeneID: 100394399
NCBI-ProteinID: XP_002750984
Ensembl: ENSCJAG00000017502
UniProt: F7E1K0
Position
7
AA seq 165 aa AA seqDB search
MTLEEFSSGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaggaattctcgtctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaggcggccaagctgctcaacgtcgacccggacaacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgatgcgggccccgcggccagcgagggcgccgagcaaccccct
gacctgcactgcgtgctggtgacgaatccacattcttctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405303Help
Entry
100405303         CDS       T03264                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100405303 (GADD45G)
   04068 FoxO signaling pathway
    100405303 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100405303 (GADD45G)
   04210 Apoptosis
    100405303 (GADD45G)
   04115 p53 signaling pathway
    100405303 (GADD45G)
   04218 Cellular senescence
    100405303 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405303 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100405303 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100405303 (GADD45G)
   05212 Pancreatic cancer
    100405303 (GADD45G)
   05225 Hepatocellular carcinoma
    100405303 (GADD45G)
   05226 Gastric cancer
    100405303 (GADD45G)
   05214 Glioma
    100405303 (GADD45G)
   05216 Thyroid cancer
    100405303 (GADD45G)
   05220 Chronic myeloid leukemia
    100405303 (GADD45G)
   05217 Basal cell carcinoma
    100405303 (GADD45G)
   05218 Melanoma
    100405303 (GADD45G)
   05213 Endometrial cancer
    100405303 (GADD45G)
   05224 Breast cancer
    100405303 (GADD45G)
   05222 Small cell lung cancer
    100405303 (GADD45G)
   05223 Non-small cell lung cancer
    100405303 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100405303 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100405303 (GADD45G)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100405303 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100405303 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 100405303
NCBI-ProteinID: XP_002742758
Ensembl: ENSCJAG00000007903
UniProt: F7HV04
Position
1
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtcggcccagcgccagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcggatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggcgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaatgaggacgcctggaaggaccccgctttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412572Help
Entry
100412572         CDS       T03264                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100412572 (GADD45B)
   04068 FoxO signaling pathway
    100412572 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100412572 (GADD45B)
   04210 Apoptosis
    100412572 (GADD45B)
   04115 p53 signaling pathway
    100412572 (GADD45B)
   04218 Cellular senescence
    100412572 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412572 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100412572 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100412572 (GADD45B)
   05212 Pancreatic cancer
    100412572 (GADD45B)
   05225 Hepatocellular carcinoma
    100412572 (GADD45B)
   05226 Gastric cancer
    100412572 (GADD45B)
   05214 Glioma
    100412572 (GADD45B)
   05216 Thyroid cancer
    100412572 (GADD45B)
   05220 Chronic myeloid leukemia
    100412572 (GADD45B)
   05217 Basal cell carcinoma
    100412572 (GADD45B)
   05218 Melanoma
    100412572 (GADD45B)
   05213 Endometrial cancer
    100412572 (GADD45B)
   05224 Breast cancer
    100412572 (GADD45B)
   05222 Small cell lung cancer
    100412572 (GADD45B)
   05223 Non-small cell lung cancer
    100412572 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100412572 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100412572 (GADD45B)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100412572 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100412572 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 100412572
NCBI-ProteinID: XP_017823593
UniProt: U3FG35
Position
22
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEGDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDSWKSRGLVEVASYCEESRGNNQWVPSISLQGR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagctgctggtggccgctcagcgccaggaccgcctcacagtgggggtg
tacgagtcggccaagctgatgaatgtagacccggacagcgtggtcctgtgcctcctggcc
attgatgaggaggaggagggcgacatcgccctgcagatccacttcacgctcatccagtct
ttctgctgcgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcacag
ctcctgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgcctc
ctggtcacgaaccctcacacggactcctggaagagccgcggcttggtggaggtagccagc
tactgcgaagagagccggggtaacaaccagtgggtcccctccatctcgctccagggacgc
tga

DBGET integrated database retrieval system