KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394418Help
Entry
100394418         CDS       T03264                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05145  Toxoplasmosis
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100394418 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100394418 (BIRC2)
   04668 TNF signaling pathway
    100394418 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100394418 (BIRC2)
   04215 Apoptosis - multiple species
    100394418 (BIRC2)
   04217 Necroptosis
    100394418 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394418 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100394418 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394418 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100394418 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100394418 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100394418 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100394418 (BIRC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100394418 (BIRC2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100394418 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C
Motif
Other DBs
NCBI-GeneID: 100394418
NCBI-ProteinID: XP_009004933
Ensembl: ENSCJAG00000003804
UniProt: U3D8L7
Position
11
AA seq 617 aa AA seqDB search
MHKTASQRLFPGPWYQKIKSIMEDSTLLSDWTNSSKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDNPIEKHKQLYPSCSFIQNLVSAS
LRSTTKNTSPMRSNFAHSLSPTLEHSSLFSGSYSSPSPNPLNSRAVEDLSPLRTNPYSYA
MSTEEARFLTFHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
LTSDTTGDEIADPPIIHFGSGESSEDAVMMNTPVVKSALEMGFSRDLVKQTVQSKILTTG
ENYKTVNDIVSALLNAEDEKREEEKERQAEEMASDDLSLIRKNRMALFQQLTCVLPILDN
LLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKHCLKEIDSTLYKNLFV
DKNMKYIPTEDVSGLPLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRK
CPICRGIIKGTVRTFLS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctggtaccaaaaaattaagagt
ataatggaagatagcacgcttttgtcagattggacaaacagcagcaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccctgccggggtt
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctcatgctggataactggaaactgggagataatcctatt
gaaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgagatccaccactaagaatacgtctccaatgagaagcaattttgcacattcattatct
cccacgttggaacacagtagcttgttcagtggttcttactccagcccttcaccaaaccct
cttaattctagagcagtcgaagacttgtctccgttgaggactaacccttacagttatgca
atgagtactgaagaagccagatttcttaccttccatatgtggccattaacatttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcggaacac
cggagacattttcccaactgtccatttttggaaaattctctagaaacgctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacattcatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aacgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaaatggtttcccagatgtgagttcttgataagaatgaaa
gggcaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
ttaacttcagacactactggagatgaaattgctgatccaccaattattcattttggatca
ggagaaagttcagaagatgccgtcatgatgaatacacctgtggttaaatctgccttggaa
atgggctttagtagagacctggtaaaacaaacagttcagagtaaaatcctgacaactgga
gagaactacaaaacagttaatgatattgtatcagcacttcttaatgccgaagatgagaag
agagaagaggagaaggaaagacaagctgaagaaatggcatcagatgatttgtcattaatt
cggaagaatagaatggctctctttcaacagttgacgtgtgtgcttcctatcctggataat
cttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaacacag
attcctttacaagcaagagaactgattgataccattttggttaaaggaaatgctgcagcc
aacatcttcaaacactgtctaaaagaaattgactctacgttgtataagaacttatttgtg
gataagaatatgaagtatattccaacagaagatgtttcaggtctgccactggaagaacaa
ttgaggaggctgcaagaagaaagaacttgtaaagtgtgtatggacaaagaagtttctatt
gtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaagaaaa
tgccctatttgcaggggtataatcaagggtactgttcgtacttttctctcttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398121Help
Entry
100398121         CDS       T03264                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04390  Hippo signaling pathway
cjc05161  Hepatitis B
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100398121 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100398121 (BIRC5)
   04215 Apoptosis - multiple species
    100398121 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398121 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100398121 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100398121 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100398121 (BIRC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100398121 (BIRC5)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     100398121 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100398121 (BIRC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR
Motif
Other DBs
NCBI-GeneID: 100398121
NCBI-ProteinID: XP_002748841
Ensembl: ENSCJAG00000019490
UniProt: F7GEY1
Position
5
AA seq 142 aa AA seqDB search
MGAPMLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAKKVRRAIEQLAAME
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccccgatgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gcgggcttcatccactgcccgactgagaacgagccggacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcatctggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttctgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaagaaactgcaaagaaagtgcgccgtgccatcgagcagctggctgcc
atggagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399118Help
Entry
100399118         CDS       T03264                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05145  Toxoplasmosis
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100399118 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100399118 (BIRC3)
   04668 TNF signaling pathway
    100399118 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100399118 (BIRC3)
   04215 Apoptosis - multiple species
    100399118 (BIRC3)
   04217 Necroptosis
    100399118 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399118 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100399118 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399118 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100399118 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100399118 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100399118 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100399118 (BIRC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100399118 (BIRC3)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100399118 (BIRC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR Vac_ImportDeg
Motif
Other DBs
NCBI-GeneID: 100399118
NCBI-ProteinID: XP_002754697
Position
11
AA seq 215 aa AA seqDB search
MRSSYHCAMNNENARLLTFQMWPLTFLLPADLAKAGFYYIGPGDRVACFACGGKLSNWEP
KDDAMSEHLRHFPKCPFIGKQLQDTSRITVSNLSMQTYAARFKTFFNWPSSVLVNPEQLA
SAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIRIKGQEFIHQVQAS
CPNLLEEVAMESSFFSLLHFRFWGTCAERARYLLR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttcttaccactgtgcaatgaataatgaaaatgccagattacttacttttcag
atgtggccattgacttttctgttgccagcagatctggcaaaagcaggcttttactacata
ggacctggagacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaacca
aaggatgatgctatgtcagaacacctgagacattttcccaaatgcccgtttataggaaaa
cagcttcaagacacttcaagaatcacagtttctaatctgagcatgcagacatatgcagcc
cgctttaaaacattctttaactggccctccagtgttctagttaatcctgagcagcttgca
agtgcgggtttttattatgtgggtaacagtgatgatgtcaaatgtttttgctgtgatggt
ggactcaggtgttgggaatctggagatgatccatgggtggaacatgccaagtggtttcca
aggtgtgagtacttaataagaattaaaggacaggagttcatccatcaagttcaagccagt
tgccccaatctacttgaagaggtagctatggaaagttcttttttttctttattgcatttt
aggttttggggtacatgtgcagaacgtgcaagatatttgcttagg

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402341Help
Entry
100402341         CDS       T03264                                 

Gene name
XIAP, BIRC4
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc05145  Toxoplasmosis
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100402341 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100402341 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100402341 (XIAP)
   04215 Apoptosis - multiple species
    100402341 (XIAP)
   04217 Necroptosis
    100402341 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100402341 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100402341 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402341 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100402341 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100402341 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100402341 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100402341 (XIAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100402341 (XIAP)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100402341 (XIAP)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100402341 (XIAP)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100402341 (XIAP)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100402341 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX DUF2039
Motif
Other DBs
NCBI-GeneID: 100402341
NCBI-ProteinID: XP_002763280
Ensembl: ENSCJAG00000020553
UniProt: B0KWH9
Position
X
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADINKDEEFVEEFNRLNTFANFPSSSLVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAIGRHRKVSPNCRFINGFYFENSATQPTNPGIQNGQYKVENY
LGSRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDPVSSDRNYPNSTNLPRNPSMADYEARIITFGTWIYSVNKEQLARAGFYALGDSDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYVNNIHLTHSLEECLVRTTEKTP
SLTRRIDETIFQNPMVQEAIRMGFSFKDIKKTMEEKIQISGSNYKSLEVLVADLVNAQKD
STQDESSQTSLQNEISTEEQLRRLQEEKLCKICMDRNIAVVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggat
gaagaatttgtagaagagtttaatagattaaacacttttgctaattttccaagtagtagt
cttgtttcagcatcaacactggcaagagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagccgtagatagatggcaatatggagactcagcaatt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttattttgaaaat
agtgccacgcaacctacaaatcctggtatccagaatggtcagtacaaagttgaaaactat
ctgggaagcagaaatcattttgctttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccctgccatg
tatagtgaagaagctagactgaagtcctttcagaactggccagactatgcccacctaacc
ccaagagagttagcgagtgctggactctactacacaggtattgatgaccaagtgcagtgc
ttttgttgtggaggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccgcaatcttaacatccgaagtgaa
tctgatcctgtgagttctgataggaattacccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatcattacttttgggacgtggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgacagtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaaatggtatccagggtgtaaatatctgttggaacaaaagggacaagaatatgtaaac
aatattcatttaacccattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgaaaccatcttccaaaatcctatggtccaagaagctata
cgaatggggttcagtttcaaggacattaagaaaacaatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagac
agtacacaagatgaatcaagtcagacttcattacagaatgagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtc
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system