KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394418Help
Entry
100394418         CDS       T03264                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05145  Toxoplasmosis
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100394418 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100394418 (BIRC2)
   04668 TNF signaling pathway
    100394418 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100394418 (BIRC2)
   04215 Apoptosis - multiple species
    100394418 (BIRC2)
   04217 Necroptosis
    100394418 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394418 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100394418 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394418 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100394418 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100394418 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100394418 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100394418 (BIRC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100394418 (BIRC2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100394418 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4_2 DUF2039 NikR_C
Motif
Other DBs
NCBI-GeneID: 100394418
NCBI-ProteinID: XP_009004933
Ensembl: ENSCJAG00000003804
UniProt: U3D8L7
Position
11
AA seq 617 aa AA seqDB search
MHKTASQRLFPGPWYQKIKSIMEDSTLLSDWTNSSKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDNPIEKHKQLYPSCSFIQNLVSAS
LRSTTKNTSPMRSNFAHSLSPTLEHSSLFSGSYSSPSPNPLNSRAVEDLSPLRTNPYSYA
MSTEEARFLTFHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
LTSDTTGDEIADPPIIHFGSGESSEDAVMMNTPVVKSALEMGFSRDLVKQTVQSKILTTG
ENYKTVNDIVSALLNAEDEKREEEKERQAEEMASDDLSLIRKNRMALFQQLTCVLPILDN
LLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKHCLKEIDSTLYKNLFV
DKNMKYIPTEDVSGLPLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRK
CPICRGIIKGTVRTFLS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctggtaccaaaaaattaagagt
ataatggaagatagcacgcttttgtcagattggacaaacagcagcaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccctgccggggtt
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctcatgctggataactggaaactgggagataatcctatt
gaaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgagatccaccactaagaatacgtctccaatgagaagcaattttgcacattcattatct
cccacgttggaacacagtagcttgttcagtggttcttactccagcccttcaccaaaccct
cttaattctagagcagtcgaagacttgtctccgttgaggactaacccttacagttatgca
atgagtactgaagaagccagatttcttaccttccatatgtggccattaacatttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcggaacac
cggagacattttcccaactgtccatttttggaaaattctctagaaacgctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacattcatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aacgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaaatggtttcccagatgtgagttcttgataagaatgaaa
gggcaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
ttaacttcagacactactggagatgaaattgctgatccaccaattattcattttggatca
ggagaaagttcagaagatgccgtcatgatgaatacacctgtggttaaatctgccttggaa
atgggctttagtagagacctggtaaaacaaacagttcagagtaaaatcctgacaactgga
gagaactacaaaacagttaatgatattgtatcagcacttcttaatgccgaagatgagaag
agagaagaggagaaggaaagacaagctgaagaaatggcatcagatgatttgtcattaatt
cggaagaatagaatggctctctttcaacagttgacgtgtgtgcttcctatcctggataat
cttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaacacag
attcctttacaagcaagagaactgattgataccattttggttaaaggaaatgctgcagcc
aacatcttcaaacactgtctaaaagaaattgactctacgttgtataagaacttatttgtg
gataagaatatgaagtatattccaacagaagatgtttcaggtctgccactggaagaacaa
ttgaggaggctgcaagaagaaagaacttgtaaagtgtgtatggacaaagaagtttctatt
gtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaagaaaa
tgccctatttgcaggggtataatcaagggtactgttcgtacttttctctcttag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399118Help
Entry
100399118         CDS       T03264                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04510  Focal adhesion
cjc04621  NOD-like receptor signaling pathway
cjc04668  TNF signaling pathway
cjc05145  Toxoplasmosis
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100399118 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100399118 (BIRC3)
   04668 TNF signaling pathway
    100399118 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100399118 (BIRC3)
   04215 Apoptosis - multiple species
    100399118 (BIRC3)
   04217 Necroptosis
    100399118 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100399118 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100399118 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100399118 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100399118 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100399118 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100399118 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100399118 (BIRC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100399118 (BIRC3)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100399118 (BIRC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR Vac_ImportDeg
Motif
Other DBs
NCBI-GeneID: 100399118
NCBI-ProteinID: XP_002754697
Position
11
AA seq 215 aa AA seqDB search
MRSSYHCAMNNENARLLTFQMWPLTFLLPADLAKAGFYYIGPGDRVACFACGGKLSNWEP
KDDAMSEHLRHFPKCPFIGKQLQDTSRITVSNLSMQTYAARFKTFFNWPSSVLVNPEQLA
SAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIRIKGQEFIHQVQAS
CPNLLEEVAMESSFFSLLHFRFWGTCAERARYLLR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagaagttcttaccactgtgcaatgaataatgaaaatgccagattacttacttttcag
atgtggccattgacttttctgttgccagcagatctggcaaaagcaggcttttactacata
ggacctggagacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaacca
aaggatgatgctatgtcagaacacctgagacattttcccaaatgcccgtttataggaaaa
cagcttcaagacacttcaagaatcacagtttctaatctgagcatgcagacatatgcagcc
cgctttaaaacattctttaactggccctccagtgttctagttaatcctgagcagcttgca
agtgcgggtttttattatgtgggtaacagtgatgatgtcaaatgtttttgctgtgatggt
ggactcaggtgttgggaatctggagatgatccatgggtggaacatgccaagtggtttcca
aggtgtgagtacttaataagaattaaaggacaggagttcatccatcaagttcaagccagt
tgccccaatctacttgaagaggtagctatggaaagttcttttttttctttattgcatttt
aggttttggggtacatgtgcagaacgtgcaagatatttgcttagg

DBGET integrated database retrieval system