KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394652Help
Entry
100394652         CDS       T03264                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04350  TGF-beta signaling pathway
cjc04360  Axon guidance
cjc04510  Focal adhesion
cjc04530  Tight junction
cjc04611  Platelet activation
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
cjc04921  Oxytocin signaling pathway
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100394652 (ROCK1)
   04071 Sphingolipid signaling pathway
    100394652 (ROCK1)
   04024 cAMP signaling pathway
    100394652 (ROCK1)
   04022 cGMP-PKG signaling pathway
    100394652 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100394652 (ROCK1)
   04530 Tight junction
    100394652 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100394652 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100394652 (ROCK1)
   04670 Leukocyte transendothelial migration
    100394652 (ROCK1)
   04062 Chemokine signaling pathway
    100394652 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100394652 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100394652 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100394652 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394652 (ROCK1)
   05206 MicroRNAs in cancer
    100394652 (ROCK1)
   05205 Proteoglycans in cancer
    100394652 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100394652 (ROCK1)
   05135 Yersinia infection
    100394652 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100394652 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100394652 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100394652 (ROCK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100394652 (ROCK1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100394652 (ROCK1)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100394652 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH HR1 Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100394652
NCBI-ProteinID: XP_008977835
Ensembl: ENSCJAG00000020477
UniProt: U3DGP9
Position
13
AA seq 1354 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSSRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRSHDSEMIGDLQARITSLHEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQVEKQCSMLDVDLKQSQQKLEHLTGNKERIEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKRTEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKAVKNTSGKTS
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgaaactcgatttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaacagtccttgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgataacatgctgctcgataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaggtattaaaatcccagggtggtgatggttattatggaagagaatgtgac
tggtggtcggttggagtatttttatacgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaagtgaggttagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcttgggaaacacttcgagacactgtagcaccagttgtacctgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaagaagaaaca
ttccctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcagtcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcaaaaaacaatctataagctggaagaacagctgcat
aacgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaggagaaaatgctgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaagaaatgtagaaaacgaagtttctacattaaag
gatcagttggaagacctaaagaaagtaagtcagaattcacagcttgctaatgaaaaactg
tcacagttacaaaagcaactagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagattgaggaagagtcacacagagatgagcaagtcaattagtcagctagagtcc
ctgaacagagagttgcaagagagaaaccgaattttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatattagaagctgaacgaagagacaggagtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacacgaggaggtcaagcat
ctcaaacataatcttgaaaaagtggaaggagaaagaaaagaagctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaagtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaatcgggttgttcaggttgagaaacag
tgttccatgctagatgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatagaggatgaagttaagaatctaaccctgcaactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaggcattcgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacaaaacagtatagaggaaatgaaggacagatgcgg
gaactacaagatcagcttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ttacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggctcgagggcttctggaagaacagtattttgaattgacacaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaagcaaacagcatgctaaccaaagatattgaaatattaagaagagagaatgaa
gagctaacagagaaaatgaagaggacagaggaagaatataaattggagaaggaggaggaa
atcagtaatcttaaggctgcttttgaaaagaatatcaacactgagcgaacccttaaaaca
caggctgttaacaagttggctgaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaagaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtgcacataggaatgagcttcagatgcagttg
gccagcaaagagagtgatattgagcagttgcgagctaaacttttggacctctcagattct
acaagtgttgctagttttcctagtgctgatgaaactgatgggaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaacaagataaggag
caatccaatccatctatggtattggacatagataaactgtttcatgttcgacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcacaaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagaa
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaagacttaatt
tgtccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaaaattcctaagaatcca
ccatctggttttgttcgtgcctcccctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagcggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system