KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394659Help
Entry
100394659         CDS       T03264                                 

Gene name
IL18R1
Definition
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04668  TNF signaling pathway
cjc05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100394659 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100394659 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100394659 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100394659 (IL18R1)
   04090 CD molecules [BR:cjc04090]
    100394659 (IL18R1)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IL1 receptor family
   100394659 (IL18R1)
CD molecules [BR:cjc04090]
 Proteins
  100394659 (IL18R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_2 TIR_2 I-set V-set Ig_3 Ig_6 Ig_5
Motif
Other DBs
NCBI-GeneID: 100394659
NCBI-ProteinID: XP_008978444
Ensembl: ENSCJAG00000008271
UniProt: F7EMB0
Position
14
AA seq 539 aa AA seqDB search
MNCRELTLTLWGLIFVSTTESSCTSRPHITVVEGEPFYLKYCSSSHAHEIEANARRWQKS
SGSQKRVELNPSSSPRIGLQDHALEFWPVELNDTGSYFLQMGNHTQEWNLNVIRRNKHSC
FTEKQVTSKAVRVKRFLQITCANSYYQKLINSTSLYKNCKKLLENKGNPMIKKNAEFEDQ
GYYSCVHFLHHDGKLFNITKTFNITVLGDSGYIVPVLLGSKLNHVAVELGKDVSLNCSAL
LNQKDILYWMYENGSDVNVHEEKEIRIMTSEGKWHASKALRIENIAEHNLNFAYNCTVTS
TGGTDTKSFILVRKAAMADIPGHIFTRGMIIAVLTLVTVVCLVTVCVIYRVDLVLLYRHL
MRTDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVVPG
GAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFAPVTDF
TFLPQSLKLLKSHRVLKWKDKNSLSYNSRFWKNLLYLMPAKTVKPGRDELEVLPVLSES
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtagagaattaacattgaccctttgggggcttatatttgtaagcaccacagag
tcttcttgtacttcacgtccccacattaccgtggttgaaggggaacctttctatctgaaa
tattgctcatcttcacatgcacatgagattgaagcaaacgccagaagatggcaaaaaagc
agtggatcacagaaacgtgtggagctgaacccaagcagttcaccaaggattggtttgcaa
gatcatgctttggagttttggcctgttgagttgaatgacacaggatcttactttttacaa
atgggaaatcatactcaggaatggaacttaaatgtcatcagaagaaataaacacagctgt
ttcactgagaaacaagtaactagtaaagctgtgagagttaaaagatttttgcagataacc
tgtgcaaacagttactatcaaaaactgatcaacagcacatcattgtataagaactgtaaa
aagctactggagaacaagggaaacccaatgataaagaagaatgctgagtttgaagatcag
gggtattactcctgcgtgcatttccttcatcatgatggaaaactatttaacatcaccaaa
accttcaatataacagtattgggagatagcggttatatagttccggttcttcttggatca
aagcttaaccatgttgcagtggaattaggaaaagatgtaagcctcaactgctctgctttg
ctgaatcaaaaggatatactttattggatgtatgaaaatggatcggatgttaatgtacat
gaagagaaagaaataagaattatgacttcagaagggaaatggcatgcttcaaaagcattg
agaattgaaaatattgctgaacacaatctaaattttgcatataattgcactgtgaccagc
acaggaggcacagacaccaaaagcttcatcttggtgagaaaagcagccatggctgatatc
ccaggccacatctttacaagaggaatgatcatagctgttttgaccttggtgacagtagtg
tgcctagtgactgtgtgcgtcatttatagagttgacttggttctgctttatagacattta
atgagaacagatgaaacattaacagatggaaaaacgtatgatgcttttgtgtcttaccta
aaagaatgccgacctgaaaatggagaggagcacacctttgctgtggagattttgcccaga
gtgttggagaaacattttgggtataagttatgcatatttgaaagggatgtagtgcctgga
ggagctgttgttgatgaaatccactcactgatagagaaaagcagaagattaatcattgtt
ctaagtaaaagttatatgtctaatgaggtcaggtatgaacttgaaagtggactccatgaa
gcattggtggaaagaaaaattaaaataatcttaattgaatttgcacctgttactgacttc
acattcttgccccagtcactaaagcttttgaaatctcacagagttctgaagtggaaggat
aaaaattctctttcttataactcaaggttctggaagaatcttctttacttaatgcctgca
aaaacagtcaagccaggtagggatgaattggaagtcttgcctgttctttcagagtcttaa

DBGET integrated database retrieval system