KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395047Help
Entry
100395047         CDS       T03264                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04015  Rap1 signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04510  Focal adhesion
cjc04520  Adherens junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04670  Leukocyte transendothelial migration
cjc04916  Melanogenesis
cjc04919  Thyroid hormone signaling pathway
cjc04934  Cushing syndrome
cjc05100  Bacterial invasion of epithelial cells
cjc05160  Hepatitis C
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100395047 (CTNNB1)
   04310 Wnt signaling pathway
    100395047 (CTNNB1)
   04390 Hippo signaling pathway
    100395047 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100395047 (CTNNB1)
   04520 Adherens junction
    100395047 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100395047 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100395047 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100395047 (CTNNB1)
   04916 Melanogenesis
    100395047 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395047 (CTNNB1)
   05205 Proteoglycans in cancer
    100395047 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100395047 (CTNNB1)
   05225 Hepatocellular carcinoma
    100395047 (CTNNB1)
   05226 Gastric cancer
    100395047 (CTNNB1)
   05216 Thyroid cancer
    100395047 (CTNNB1)
   05217 Basal cell carcinoma
    100395047 (CTNNB1)
   05215 Prostate cancer
    100395047 (CTNNB1)
   05213 Endometrial cancer
    100395047 (CTNNB1)
   05224 Breast cancer
    100395047 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100395047 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100395047 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100395047 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100395047 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100395047 (CTNNB1)
   05163 Human cytomegalovirus infection
    100395047 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100395047 (CTNNB1)
   05165 Human papillomavirus infection
    100395047 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 100395047
NCBI-ProteinID: XP_008982325
Ensembl: ENSCJAG00000017918
UniProt: F6SAX7
Position
17
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagca
gctgttagtcactggcagcaacagtcctacctggactctggaatccattctggcgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctatatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagccgctatgttcccg
gagacactagatgagggcatgcagatcccatctacacagtttgatgctgctcaccccacc
aatgtccagcgtttggctgaaccgtcacagatgctgaaacatgccgttgtaaacttgatc
aactatcaggatgatgcagaacttgccacacgcgcaatccccgaactcacaaaactgctc
aatgatgaggaccaggtggtggtgaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtactgctgggaccttgcataac
ctttcccatcatcgggagggcttgctggccatctttaaatctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttgttacaccaagaaggagccaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttatggcaaccaagaaagcaagctgattatactggccagtggtgga
ccccaagccttagtaaatataatgaggacctacacttatgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggcgacagggaggacatc
actgagcctgccatctgtgcccttcgccatctgaccagccgacaccaagaagcagagatg
gctcagaatgcagttcgccttcactatggactcccagttgtggttaagctcctacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
cccgcgaatcatgctcctttgcgtgagcagggtgccattccacgactagtccagttgctt
gttcgcgcacatcaggacacccagcgccgtacatccatgggtgggacacagcagcaattt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgtcatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgaccctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatcccgttgatgggctgccagatctggggcatgctcag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system