KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395166Help
Entry
100395166         CDS       T03264                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00480  Glutathione metabolism
cjc00590  Arachidonic acid metabolism
cjc01100  Metabolic pathways
cjc04918  Thyroid hormone synthesis
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100395166 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100395166 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100395166 (GPX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100395166 (GPX3)
   05016 Huntington disease
    100395166 (GPX3)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100395166 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 100395166
NCBI-ProteinID: XP_003732305
Ensembl: ENSCJAG00000020924
Position
2
AA seq 227 aa AA seqDB search
MARLLQASCLLSLLLAGFVLQSRGQVKSKVDCHGGMSGTIYEYGALTISGEEYVPFKQFA
GKYLLFVNVATYUGLTGQYIELNALQEELAPFGLVVLGFPCNQFGKQEPGENSEILPSLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELVGTSDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILLYMRHRQAAQEVKRK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgctgcaggcgtcctgcctgctctccctgcttctggccggcttcgtcctg
cagagccggggacaagtgaagtcgaaggtggactgccatggtggcatgagcggcaccatt
tatgagtacggagccctcaccatcagtggggaggagtacgtccccttcaagcagtttgct
ggcaaatacctcctctttgtcaacgtggccacctactgaggcctgacgggccagtacatt
gaactgaatgcactacaggaagagcttgcaccatttggtttggtcgttctgggctttccc
tgcaaccaatttggaaaacaggaaccaggagagaactcggagattctccccagcctcaag
tatgtccgaccaggtgggggcttcgtccccaatttccagctgtttgagaaaggggatgtg
aatggagagaaagagcagaaattctacactttcctaaagaactcctgtcctcccacctcg
gagctcgtgggtacatctgaccgtctcttctgggaacccatgaaggtccatgacatccgc
tggaatttcgagaagttcctggtggggccagatggtatacccatcatgcgctggcaccac
cggaccacggtcagcaacgttaagatggacatcctgttatacatgaggcaccggcaggca
gcccaggaggtcaagaggaagtaa

DBGET integrated database retrieval system