KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395220Help
Entry
100395220         CDS       T03264                                 

Gene name
CASP8
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05134  Legionellosis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100395220 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100395220 (CASP8)
   04215 Apoptosis - multiple species
    100395220 (CASP8)
   04217 Necroptosis
    100395220 (CASP8)
   04115 p53 signaling pathway
    100395220 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100395220 (CASP8)
   04621 NOD-like receptor signaling pathway
    100395220 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    100395220 (CASP8)
   04625 C-type lectin receptor signaling pathway
    100395220 (CASP8)
   04657 IL-17 signaling pathway
    100395220 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395220 (CASP8)
   05203 Viral carcinogenesis
    100395220 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100395220 (CASP8)
   05016 Huntington disease
    100395220 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100395220 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100395220 (CASP8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100395220 (CASP8)
   05152 Tuberculosis
    100395220 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100395220 (CASP8)
   05162 Measles
    100395220 (CASP8)
   05164 Influenza A
    100395220 (CASP8)
   05161 Hepatitis B
    100395220 (CASP8)
   05160 Hepatitis C
    100395220 (CASP8)
   05168 Herpes simplex virus 1 infection
    100395220 (CASP8)
   05163 Human cytomegalovirus infection
    100395220 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100395220 (CASP8)
   05169 Epstein-Barr virus infection
    100395220 (CASP8)
   05165 Human papillomavirus infection
    100395220 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100395220 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    100395220 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100395220 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100395220 (CASP8)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100395220 (CASP8)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C14: caspase family
   100395220 (CASP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED PYRIN Guanylin
Motif
Other DBs
NCBI-GeneID: 100395220
NCBI-ProteinID: XP_008997455
Ensembl: ENSCJAG00000004551
Position
6
AA seq 485 aa AA seqDB search
MVPGKGGADYIYLPFGKMAFSKMLFNIGEELGSEELAALKFLSLDYIPQRKQEPIKDALM
LFQRLQEKRMLEESNLFFLKELLFRINRLDLLNKYLHTSKEEMERELQTPGSAQISAYRV
MLYQISEDVSRSELRSFKFLLKKEISKCKLDDDMNLLDIFIEMEKRVILGEEKLDVLKRV
CDQINKSLLKIINDYEEFSRGAELLFVFICSVXPTESALEWVFVFQTSDKVYQMKSKPRG
YCLIINNHDFRKAREEVPKLHSIKDRNGTHLDAEALSKTFKELHFEIRPYNDCTREEIYE
ILQSYQRMDHSNKDCFICCILSHGDKGIIYGTDGHEAPIYELTSQFTGLKCPSLAGKPKV
FFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQKRYIPDEADFLLGMATVNNCVSYRN
PVEGTWYIQSLCQSLKERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKL
VFSSD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccggaaagggtggagcggattacatctacctaccttttggaaagatggccttc
agcaaaatgctttttaatattggggaagaactgggaagtgaagaactggccgccctcaag
ttcctgagcctggactacataccacaaaggaagcaagaacccatcaaggatgccttgatg
ttattccagagactccaggaaaagagaatgttggaggaaagtaatctgttctttctgaag
gagctgctcttccgaattaatagattggatttgttgaataaatatctgcacactagcaag
gaggagatggaaagggaacttcagacaccgggcagtgctcagatttctgcctacagggtc
atgctctatcagatttcagaagatgtgagcagatcagaattgaggtcttttaagtttctt
ttgaaaaaggagatctccaaatgcaaactggatgatgacatgaacctgctggatattttc
atagagatggagaagagggtcatcctgggagaagaaaagttggatgtcctgaaaagagtc
tgtgaccaaatcaacaagagcctgctgaagataatcaacgactatgaagaattcagcaga
ggtgcagagttattgtttgttttcatctgcagtgtttgacccacagagtcagctcttgaa
tgggtttttgttttccagacttcagacaaagtttaccaaatgaaaagtaaacctcgggga
tattgtctgatcatcaacaatcatgactttcgcaaagcacgggaggaagtgcccaaactc
cacagcattaaggataggaatggaacacacctggatgcagaggctttgagcaagaccttt
aaggagcttcattttgagatcaggccctacaatgactgcacaagagaggaaatctatgag
attttgcaatcctaccaacgcatggaccacagtaacaaggactgcttcatctgctgtatc
ctctcccatggagacaagggcatcatctacggcactgatggacacgaggcccccatatat
gagctgacatctcagttcactggtttgaagtgcccttcccttgctggaaaaccaaaagtg
ttttttattcaggcttgtcagggggataactaccagaaaggtatacctgttgagactgat
tcagaggagcaaccctatttagaaatggacttatcatcacctcagaaaagatatatccca
gatgaggctgactttctactggggatggccactgtgaataactgtgtttcctaccgaaac
cctgtggagggaacctggtatatccagtcactttgccagagcctgaaagaacgatgtcct
cgaggcgatgatattctcaccatcctgactgaagtgaactatgaagtcagcaacaaagac
gataagaaaaacatgggcaagcagatgccgcagcctactttcacactaagaaaaaaactt
gttttctcttctgattga

DBGET integrated database retrieval system