KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395278Help
Entry
100395278         CDS       T03264                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04310  Wnt signaling pathway
cjc04330  Notch signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04520  Adherens junction
cjc04630  Jak-STAT signaling pathway
cjc04720  Long-term potentiation
cjc04916  Melanogenesis
cjc04919  Thyroid hormone signaling pathway
cjc04922  Glucagon signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05016  Huntington disease
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100395278 (EP300)
   04330 Notch signaling pathway
    100395278 (EP300)
   04350 TGF-beta signaling pathway
    100395278 (EP300)
   04630 Jak-STAT signaling pathway
    100395278 (EP300)
   04066 HIF-1 signaling pathway
    100395278 (EP300)
   04068 FoxO signaling pathway
    100395278 (EP300)
   04024 cAMP signaling pathway
    100395278 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100395278 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100395278 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100395278 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100395278 (EP300)
   04919 Thyroid hormone signaling pathway
    100395278 (EP300)
   04916 Melanogenesis
    100395278 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100395278 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395278 (EP300)
   05206 MicroRNAs in cancer
    100395278 (EP300)
   05203 Viral carcinogenesis
    100395278 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100395278 (EP300)
   05215 Prostate cancer
    100395278 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100395278 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100395278 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100395278 (EP300)
   05164 Influenza A
    100395278 (EP300)
   05161 Hepatitis B
    100395278 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100395278 (EP300)
   05165 Human papillomavirus infection
    100395278 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100395278 (EP300)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100395278 (EP300)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100395278 (EP300)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100395278 (EP300)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100395278 (EP300)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100395278 (EP300)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100395278 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 100395278
NCBI-ProteinID: XP_017819353
Ensembl: ENSCJAG00000004770
Position
1
AA seq 2416 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQSMQYPNPSMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKVGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGGMS
SMGQQPASQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVASLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AGGMVPVSMNPGPNMGQPQPGMTSNGPLPDPTMIRGSVPNQMIPRITSQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFPSQGMNVTNM
SLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAIPSGPQSQALHPPPRQTPTPPTQLTPQVQSSL
PAAPSADQSQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQLAVNTEGQVSNPPSTSSTE
VNSQAIPEKQPSQEVKMEAKMEVDQPEPADTQPEDITESKVDDCKVEPTETEERGTDSKT
EIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLH
HEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPS
EGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKEL
PYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS
SLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPC
DLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRW
HCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKC
PVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQ
QPTTPQTPQPTSQPQPTPPSSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGP
PPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMAPMAPMGMNPPPMTRGPSGHLE
PGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPL
KPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQSLP
GQPGMPQGQPGLQPPTMPGQQAVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGM
SPQAQQMNMNHNAMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPP
QQQQQQQRMQHHMQQMQQGNIGQMGQLPQALGAEAGASLRGLSAGSLQQQMGSPAQPNPM
SPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPH
HVSPQTSSPHPGLVAAQANPMEQGHFASPEQNSMLSQLTSNPGMANLHGASATDLGLSTD
NSDLNSNLSQSTLDIH
NT seq 7251 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggttctctctttgacttggag
cacgacttaccagatgaattaatcaactctacagagttgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacag
ctatcagaattgctgcgatctggtagttcgcctaacctcaatatgggagttggtggccca
ggtcaagtcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatgggaatgggcact
agtggaccaaatcagggtcctacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagagtatgcagtacccaaacccaagcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccgcag
cctcttaaggtgggaatgatgaacaatcccaatccttatggttcaccatatactcagaat
cctggacagcagattggagccagtggccttggtctccagattcaaacaaagactgtacta
tcaaataacttacctccatttgcaatggataaaaagacagttcctggtggaggaatgtcc
agcatgggccaacagccagcctcgcaggtccagcagccaggcctggtgactccggttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcacgctcacaagtgccagcgccgagagcaagccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgtcagtcaggcaagtcttgccaagtggcacactgtgcgtcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacctgttggacttggaaatcct
agctctctaggggtgggtcaacagtctacccccaacctaagtactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccaacacaaccccaggtgcaagcaaagaaccagcagaatcagcagtctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagctataaattctcaa
aacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcatgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacaccagatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggcgacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggactagactacagaaacagaacatgctaccaaat
gctggaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggtcctctgcctgatccaactatgatccgtggcagtgtgccaaac
cagatgatccctcggataacttcacagtctggtttgaatcaatttggccagatgagcatg
gcccagccccctattgtaccccggcaaacccctcctcttcagcaccatggacagttggct
cagcctggaactctcaacccgcctatgggctatgggcctcgtatgcagcagccttccagc
cagagccagttccttcctcagactcagttcccatcacagggaatgaatgtaacaaatatg
tctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccagtgaactctcctataatgcctccagggtctcaggggagccacattcactgtccc
cagcttcctcaaccagctctgcatcagaattccccctcgcctgtacctagtcgtacccct
accccccatcatactcccccaagcataggggctcagcagccaccagcaacagcaattcca
gcccctgttcctacgcctcctgccattccatctgggccacagtcccaggctttacatccc
cctccaaggcagacacctacaccaccaacacaacttaccccacaagtgcagtcttcactt
cctgctgctccttcagctgaccagtcccaacagcagcctcgctcacagcagagcacagca
gcctctgttcctaccccaacagcaccgctgcttcctccacagcctgcaactccactttcc
cagctagctgtaaacactgaaggacaggtatcaaaccctccatctactagtagcacagaa
gtgaattctcaggccattcctgagaagcaaccttcccaggaagtgaaaatggaggctaaa
atggaggtggatcaaccagaaccagcagatactcagccggaggatattacagagtctaaa
gtagatgactgtaaagtggaacctacagaaacagaagagagaggcactgattcaaaaact
gaaataaaagaggaggaagaccagccaagtacttcagctacccagtcatctccagctccg
ggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactgatgccaacg
ttggaggcactttaccgtcaagatccagaatcccttccttttcgtcagcctgtggaccct
cagcttttaggaatccctgattactttgatattgtgaagagccctatggatctttctaca
attaagaggaagttagacactggacagtatcaggagccctggcaatatgttgatgatatt
tggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaatac
tgctccaaactatctgaggtctttgaacaggaaattgacccagtgatgcaaagccttgga
tactgttgtggcagaaagttggaattctctccacaaacactgtgttgctatggcaaacag
ttatgcacaatacctcgtgatgccacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcccag
cctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggatcct
gaactgtttgttgaatgtacagagtgcggaagaaagatgcatcaaatctgtgtccttcac
catgagataatctggcctgctggattcgtctgtgatggctgtttaaagaaaagtgcacga
actaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggtaccttt
ctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagaggtc
actgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaagca
aggtttgtggacagtggagagatggcagaatcctttccgtaccgaaccaaagccctcttt
gcctttgaagaaattgatggtgttgacctgtgcttctttggcatgcatgttcaagagtat
ggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcctgaggactgcagtctatcatgaaatcctaattggatat
ttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgtccaccaagt
gagggagatgattatatcttccattgccatcctcctgaccagaagatacccaagcccaag
cgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtccat
gactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaattg
ccttacttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactggag
caagaggaggaagagagaaaacgagaagaaaacaccagcaatgaaagcacagatgtgacc
aagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataagagc
agcctgagtaggggcaacaagaagaaacctgggatgcccaatgtatctaacgacctctca
cagaaactgtatgccaccatggagaagcataaagaggtcttctttgtgatccgcctcatt
gctggccctgctgccaactccctgcctcccattgttgaccctgaccctctcatcccctgc
gatctgatggatggtcgggatgcgtttctcacgctggcaagggacaagcacctggagttc
tcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacacag
agccaggaccgctttgtctacacctgtaatgaatgcaagcaccatgtggagacacgctgg
cactgcactgtctgtgaggattatgacttgtgtatcacttgctataacactaaaaaccat
gaccacaaaatggagaaactaggtttgggcttagatgatgagagcaacaaccagcaggct
gcagccacccagagcccaggcgattcccgccgcctgagtatccagcgctgcatccagtct
ctggtccatgcttgccagtgtcggaatgccaattgctccctgccctcctgccagaagatg
aagcgggttgtacagcatactaagggttgcaaacggaaaaccaatggtgggtgccccatc
tgcaagcagctcattgccctctgctgctaccatgccaagcactgccaggagaacaaatgc
ccggtgccgttctgcctaaatatcaaacagaagctccggcaacagcagctccagcaccga
ctacagcaggcccaaatgcttcgcaggcggatggccagcatgcagcggactggtgtggtc
gggcaacaacagggcctgccttctcccactcctgccactccaacaacaccaactggccaa
cagccaaccaccccacagacaccccagcccacctctcagcctcagcctacccctcccagt
agcatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaaggca
gcaggccaggtgacccctccaaccccccctcagactgctcagccaccccttccagggccc
ccacctgcagcagtggaaatggcaatgcagattcagagagcagcagagacacagcgccag
atggcccatgtgcaaatttttcaaaggccaatccaacaccaaatgcctccaatggctccc
atggcccccatgggtatgaatccacctccaatgaccagaggtcccagtgggcatttggag
ccagggatgggaccaacagggatgcagcaacagccaccctgggcccaaggaggattgcct
cagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccagcat
ggtcaacccttgaacatggctccacaaccaggattgggccaggtaggtgtgagcccactc
aaaccaggcactgtgtctcagcaagccttacaaaaccttctgcggactctcaggtctccc
agctctcctttacagcagcaacaggtgcttagtatccttcatgccaacccccaactgttg
gctgcattcatcaagcagcgggctgccaagtatgccaactctaatccgcaatccctccct
gggcagcctggcatgccccaggggcagccagggctacagccacctaccatgccagggcag
caggcggtccactccaatccagccatgcagaacatgaatccaatgcaggcaggcgtccag
agggctggcctgccacagcagcaaccacagcagcaactccagccacccatgggagggatg
agcccccaggctcagcagatgaacatgaaccacaacgccatgccttcacagttccgagac
atcttgagacgacagcagatgatgcagcaacagcagcagcagggagcagggccaggaata
ggccctggaatggccaaccataatcagtttcagcaaccccaaggcgttggctacccaccc
cagcagcagcagcaacagcagcggatgcagcatcacatgcaacagatgcaacaaggaaat
ataggacagatgggccagctcccccaggccttgggagcagaggcaggtgccagtttacga
ggcctatcagcagggagtcttcagcaacagatggggtcccctgctcagcccaaccccatg
agcccccagcagcatatgctcccaaatcaggcccagtccccacacctacaaggccagcag
atccctaattctctctccaatcaagtgcgttctccccagcctgtcccctctccacggcca
cagtcccagcccccccactccagcccttccccaaggatgcagcctcagccttctccacac
cacgtttccccacagacaagttccccacatcctggactggtagctgcccaggccaaccct
atggaacaagggcattttgccagcccggagcagaattcaatgctttctcagctcactagc
aatccaggcatggcaaacctccatggtgcaagcgccacggacctgggactcagcaccgat
aactcagacttgaattcaaacctctcacagagtacactagacatacactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405037Help
Entry
100405037         CDS       T03264                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04310  Wnt signaling pathway
cjc04330  Notch signaling pathway
cjc04350  TGF-beta signaling pathway
cjc04520  Adherens junction
cjc04630  Jak-STAT signaling pathway
cjc04720  Long-term potentiation
cjc04916  Melanogenesis
cjc04919  Thyroid hormone signaling pathway
cjc04922  Glucagon signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05016  Huntington disease
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05206  MicroRNAs in cancer
cjc05211  Renal cell carcinoma
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100405037 (CREBBP)
   04330 Notch signaling pathway
    100405037 (CREBBP)
   04350 TGF-beta signaling pathway
    100405037 (CREBBP)
   04630 Jak-STAT signaling pathway
    100405037 (CREBBP)
   04066 HIF-1 signaling pathway
    100405037 (CREBBP)
   04068 FoxO signaling pathway
    100405037 (CREBBP)
   04024 cAMP signaling pathway
    100405037 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100405037 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100405037 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100405037 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100405037 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100405037 (CREBBP)
   04916 Melanogenesis
    100405037 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100405037 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405037 (CREBBP)
   05206 MicroRNAs in cancer
    100405037 (CREBBP)
   05203 Viral carcinogenesis
    100405037 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100405037 (CREBBP)
   05215 Prostate cancer
    100405037 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100405037 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100405037 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100405037 (CREBBP)
   05164 Influenza A
    100405037 (CREBBP)
   05161 Hepatitis B
    100405037 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405037 (CREBBP)
   05165 Human papillomavirus infection
    100405037 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100405037 (CREBBP)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100405037 (CREBBP)
   03029 Mitochondrial biogenesis [BR:cjc03029]
    100405037 (CREBBP)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100405037 (CREBBP)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100405037 (CREBBP)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100405037 (CREBBP)
Mitochondrial biogenesis [BR:cjc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100405037 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 100405037
NCBI-ProteinID: XP_009007316
Ensembl: ENSCJAG00000019712
Position
12
AA seq 2449 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLTSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMSSLGAMGK
SPLSQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKLATSSPTTSQTGPGICMNANFNQ
THPGLLNSNSGHSLMNQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLAETL
TQVSPQMAGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSM
VNSLPTFPTDIKNTSVTNVPNMSQMQTTVGIVPTQAIATGPTADPEKRKLIQQQLVLLLH
AHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCT
RHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQR
AYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMTIPAGGITTDQQPP
NLISESALPTSLGAANPLMNDGSNSGSIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSH
LVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQK
ELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLPLPVNRMQVSQGMNS
FNPMSLGNVQLPQAPMGPRTASPMNHSVQINSMGSVPGMAISPSRMPQPPNMMGAHTNNM
MAQAPAQSQFLPQNQFPSSSGAMSVNSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQTAAQSQVTPQPQTPAQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKVEAHTENTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDTAEQKSEPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDXMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCXEMKR
VVQHTKAVSXQTNGGCPVCSTPSPSAANHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSAGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNG
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGMPRPVM
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGLQPQPGLQPQPGMQPQPGMQPQPGIHQQPSLQNLNAMQAGVPRPGV
PPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQ
QQQGNAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMPQHLPLQGSSIGQMAAQMGQLSQ
MGQPGMGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQ
QIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMAS
SIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7350 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacttgctggacggacctcctaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaccagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcagctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgcgaacatgtccagcctcggtgccatgggcaag
agtcctctgagccagggagattcttcagcccccagcctgccaaaacaggcagccagcacc
tctgggcccaccccccctgcctcccaggcactgaatcctcaagcacaaaagctggcgact
agcagccctaccacgtcacagactggacctggtatctgcatgaatgctaactttaaccag
acccacccaggcctcctcaatagtaactctggccatagtttaatgaatcaggcttctcaa
ggacaggcgcaagtcatgaatggatctcttggggctgctggtagaggaaggggagctgga
atgccataccctactccagccatgcagggggccacgagcagcgtgctggctgagacccta
acgcaggtttccccgcaaatggccggccacgcaggactgaacaccgcacaggcaggaggc
atggccaagatgggaataactgggaacacaagtccgtttggacagccctttagtcaagct
ggagggcagccaatgggagccactggagtgaacccccagttagccagcaaacagagcatg
gtcaacagtttgcccaccttccctacagacatcaagaatacttcagtcaccaacgtgcca
aatatgtcccagatgcaaacaacagtgggaattgtacccacacaagcaattgcaacgggc
cccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactgcttcat
gctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgctcgctccca
cactgtcgaaccatgaaaaacgttttgaatcacatgacgcactgtcaggctgggaaagcc
tgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaactgcaca
cgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaaccaacaa
accatcctggggtctccggctagtgggattcaaaacacaattggttctgttggcacaggg
caacagaatgccacttctttaagtaacccaaatcccatagaccccagctccatgcagcga
gcctatgctgctctcggactcccctacatgaaccagccccagacgcagctgcagcctcag
gttcctggccagcaaccagcacagcctcaaacccaccagcagatgaggactctcaacccc
ctgggaaataacccaatgacgattccagcaggaggaataacaacagatcagcagccccca
aacttgatttcagaatccgctcttccaacttccctgggggctgcaaaccccctgatgaac
gatggctccaactctggtagcattggaactctcagtaccataccaacagcagctcctcct
tccagcactggtgtaaggaaaggctggcacgaacatgtcactcaggacctgcggagccat
ctagtgcataaactagtccaagccatcttcccaacaccagatcccgcagctctaaaggat
cgccgcatggaaaacctggtagcctatgctaagaaagtggaaggggacatgtacgagtct
gccaacagcagggatgaatattatcacttactagcagagaaaatctacaagatacaaaaa
gaactagaagaaaaacggaggtcgcgtctacataaacaaggcatcttggggaaccagcca
gccctaccagccccaggggctcagccccctgtgattccacaggcacaacctgtgagaccc
ccaaatggacccctaccccttccagtgaatcgcatgcaagtttctcaagggatgaattca
tttaaccccatgtctttggggaacgtccagttgccacaagcacccatgggacctcgtaca
gcctccccaatgaaccactctgtacagatcaacagcatgggctcagtgccagggatggcc
atttctccttcccgaatgcctcagcctccaaacatgatgggtgcgcacaccaacaacatg
atggcccaggcgcccgctcagagccagtttctgccacaaaaccagttcccgtcatccagc
ggagcgatgagtgtgaacagtgtggggatgggccagccgccagcccagacaggcgtgtca
cagggacaggtgcctggtgctgctcttcctaaccctctcaacatgttggggcctcaggcc
agccagctgccctgccctccagtgacacagtcaccgttgcacccgacaccacctcctgct
tccacggctgctggcatgccatctctccagcaccctacaccacctgggatgactcctccc
cagccagcagctcccactcagccatcaactcctgtgtcgtcttccgggcagactcctacc
ccgactcctggctcagtgcccagtgctacccaaacccagagcacccctacagtccaaaca
gcagcccagtcccaggtgaccccacagcctcaaaccccagctcagcccccgtctgtggct
acccctcagtcatcgcagcagcagccaacacctgtgcacgcccagcctcctggcacgccg
ctttcccaggcagcagccagcattgataacagggtccctaccccgtcctcggtggccagt
gcagaaaccaattcccagcagccaggacccgatgtacctgtgctagaaatgaaggtggag
gcccacacagagaacactgagcccgatcctggtgaatccaagggggagccccggtctgag
atgatggaggaggatttgcaaggtgcttctcaagttaaagaagaaacagatacagcagag
cagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaagttaaa
gaggaagaggagagtagcactaacggcacagcctctcagtcaacgtctccctcacagccg
cgcaaaaaaatctttaaaccagaggagttacgtcaggcactcatgccgaccctagaagca
ctgtatcgacaggacccagagtctttacctttccggcagcctgtagatccccagctcctt
ggaattccagattattttgacattgtaaagaatcccatggacctctcgaccatcaagcgg
aagctggacacagggcaataccaagagccctggcagtatgtggacgacgtctggctcatg
ttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttctgcagtaag
cttgcagaggtctttgagcaggaaattgaccctgtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttttccccacagactttgtgctgctatgggaagcagctgtgtacc
attcctcgagatgccgcctactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacaaccccaaacg
acaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagaccctgaacctttc
gttgattgcaaggagtgtggccggaagatgcatcagatctgcgttctgcactatgacatc
atttggccttcaggttttgtatgcgataactgcttgaagaaaactggcagacctcgaaaa
gaaaacaagttcagtgctaagagactgcagaccacgagactgggaaaccacttggaagac
cgagtgaacaaatttttgcgacgccagaatcaccctgaagccggggaggtttttgttcga
gtggtggccagctcagacaagacggtggaggtcaagcctggaatgaagtcacggtttgtg
gattctggggaaatgtctgaatctttcccatatcgaaccaaagcactgtttgcttttgag
gaaattgacggcgtggatgtctgcttttttggaatgcacgtgcaagaatacggctctgat
tgcccccctccaaatacgaggcgggtgtacatttcttatctggacagtattcatttcttc
cggccgcgttgcctccgcacagctgtttaccatgagatccttattggatatctagagtat
gtgaagaaattggggtatgtgacagggcacatctgggcctgtcctccaagtgaaggagat
gattatatcttccactgccacccacctgatcaaaaaatccccaagccaaaacgactgcag
gaatggtacaaaaagatgctggacaaggcgtttgcagagcggatcattcatgactacaag
gacattttcaaacaagcaactgaagacagactcaccagtgccaaggaactgccctatttt
gaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaa
gaggagaggaaaaaggaagagagcaccgcagccagtgaaaccaccgagggcagtcagggc
gacagcaagaatgccaagaagaagaacaataagaagaccaacaagaacaaaagcagcatc
agccgcgccaataagaagaagcccagcatgcccaacgtgtccaatgacctgtcccagaag
ctctatgccaccatggagaaacacaaggaggtcttcttcgtgatccacttgcacgccggg
cctgtcatcaacaccttgccccccatcgtcgatcccgaccccctgcttagctgcgacntc
atggacgggcgagatgccttcctcaccctcgccagagacaagcactgggagttctcctcc
ttgcgccgctccaagtggtccacgctgtgtatgctggtggagctgcacacccagggccag
gaccgcttcgtctatacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
actgtgtgcgaggactacgacctctgcatcaactgctataacacgaagagccatgcccat
aagatggtgaagtgggggctgggtctggacgacgagggcagcagccagggcgagccacag
tcaaagagcccccaggagtcccgccggctgagcatccagcgctgcatccagtctctggtg
cacgcatgccagtgccgcaacgccaactgctcgctgccatcctgcnnagagatgaagcgg
gtggtgcagcacaccaaggctgtaagcnngcagaccaatgggggctgcccggtgtgtagc
actccatcgccttctgctgctaaccacgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttctcctacctcagcaccacctgggacccccacgcagcagcccagcacaccc
cagacgccgcagccccctgcccagccccagccctcacccgtgagcatgtcaccagctggc
ttccccagcgtggcccggactcagccccccaccacggtgtctgcagggaagcccaccagc
caggtgccagcacccccgcccccggcccagcccccacctgcagcggtggaagcggctcgg
cagatcgagcgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaatggc
atgcccccaggacgcacgggcatggggaccccaggaagccagatggcccctgtgagcctg
aacgtgccccgacccaaccaggtgagcgggcctgtcatgcccagcatgcctcccggccag
tggcaacaggcaccccttccccagcagcagccgatgccaggcatgcccaggcctgtgatg
tccatgcaggcccaggcagctgtagccgggccccggatgcccagcgtgcagccacccaga
agcatctcccccagcgccctgcaagacctgctgcggaccctgaagtcacccagctcccct
cagcagcagcagcaggtgctgaacattctcaagtcaaacccgcagctaatggcagctttc
atcaaacagcgcacagccaagtatgtggccaatcagcccggcctccagccccagcccggc
ctccagccccagcccggcatgcagccccagcccggcatgcagccccagcctggcatacac
cagcagcccagcctacagaacctgaacgccatgcaggctggcgtgccacggcccggtgtg
cctccacagcagcaggcaatgggaggcctgaacccccagggccaggccctgaacatcatg
aacccaggacacaaccccaacatggcgagtatgaatccacagtaccgagaaatgttacgg
aggcagctgctgcagcagcagcaacagcagcaacagcagcagcagcaacagcagcagcag
cagcagcaagggaatgctggcatggctgggggcatggcagggcacggccagttccagcag
cctcaaggacctggaggctacccgccagccatgcagcagcagcagcgcatgccacagcat
ctccccctccagggcagctccataggccagatggcggcccagatgggacagctcagccag
atggggcagccagggatgggggcagacagcacccccaacatccagcaagccctgcagcag
cggattctgcagcaacagcagatgaagcagcagattgggtccccaggccagccgaatccc
atgagcccccagcaacacatgctctcaggacagccacaggcctcgcatcttcctggccag
cagatcgccacatcccttagtaaccaggtgcggtctccagcccctgtccagtctcctcgg
ccccagtcccagcctccacattccagcccgtcaccacggatacagccccagccttcgcca
caccacgtctcaccccagactggttccccccaccccggactcgcagttactatggccagc
tccatagatcagggacacctggggaaccccgaacagagtgcaatgctcccccagctgaac
acccccagcaggagtgcgctgtccagcgaactgtccctggtcggggacaccacgggggac
acgctagagaagtttgtggagggcttgtag

DBGET integrated database retrieval system