KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395283Help
Entry
100395283         CDS       T03264                                 

Gene name
PTK2
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04062  Chemokine signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04670  Leukocyte transendothelial migration
cjc04810  Regulation of actin cytoskeleton
cjc05100  Bacterial invasion of epithelial cells
cjc05146  Amoebiasis
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05222  Small cell lung cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100395283 (PTK2)
   04370 VEGF signaling pathway
    100395283 (PTK2)
   04151 PI3K-Akt signaling pathway
    100395283 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100395283 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100395283 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100395283 (PTK2)
   04062 Chemokine signaling pathway
    100395283 (PTK2)
  09158 Development
   04360 Axon guidance
    100395283 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395283 (PTK2)
   05202 Transcriptional misregulation in cancer
    100395283 (PTK2)
   05205 Proteoglycans in cancer
    100395283 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100395283 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100395283 (PTK2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100395283 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100395283 (PTK2)
   05163 Human cytomegalovirus infection
    100395283 (PTK2)
   05165 Human papillomavirus infection
    100395283 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100395283 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100395283 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100395283 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100395283 (PTK2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100395283 (PTK2)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  FAK family
   100395283 (PTK2)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100395283 (PTK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase FERM_F2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 100395283
NCBI-ProteinID: XP_002759251
Ensembl: ENSCJAG00000003921
Position
16
AA seq 1052 aa AA seqDB search
MAAAYLDPNLNHTPNSSAKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFII
RPQKEGERALPSIPKLANSEKQGMRTHPVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGVYISPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHVVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQADSWNHRPQE
ISMWQPNVEDSTALDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHPGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttatcttgaccccaacttgaatcacacaccaaattcgagtgctaagact
cacctgggtactggtgtggaacgttctcctggtgcgatggagcgagtattaaaggtcttc
cattattttgaaagtaatagtgagccaaccacctgggccagtatcatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gacatgggcgtctccagtgtgagggagaagtatgagcttgcccacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagtgattatatgttagagatagct
gatcaagtggaccaggacattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgattcaacaaacatttagacaattcgccaaccttaatagagaagagagtatt
ctgaaattctttgagatcctgtctccagtgtacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcaatcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacctgagcctctgacagtgacggccccatccctaaccattgcagagaatatg
gctgacctgatagatgggtactgccgactggtgaatggagcctctcagtcgtttatcatc
agaccccagaaagaaggtgaacgggctttgccgtcaataccaaagctggccaacagtgaa
aagcaaggcatgcggacacaccccgtctctgtgtcagagacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagagattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcgtt
tatatcagtccagagaatccagctttggcagttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtgaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagcacagctcttgcatatttagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctagtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtatgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ctaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagaacgcatgaggatggagtccagaagacaggctaca
gtctcctgggactccggagggtctgatgaagcgccgcccaagcccagcagaccaggttat
cctagtccgagatccagcgaaggattttatcccagcccacagcacgtggtgcaaaccaat
cattaccaggtctcaggctaccctggttcacatggaatcacagctatggctggcagcatc
tatccaggtcaggcatctcttttggaccaagcagattcatggaatcatagacctcaggag
atatcaatgtggcagcccaatgtggaggactctacagcattggacctgcgagggattggg
caagtgttgccaacccacctgatggaagaacggctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagcattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccagatcctgcagctccaccaaagaagccacctcgccctgga
gcccccggtcacccgggaagccttgccagcctcagcagccctgcagacagctacaacgag
ggtgtcaagcttcagccccaggaaatcagccccccacctactgccaacctggaccggtca
aatgataaggtgtatgagaatgtgacgggcctggtgaaagctgtcatcgagatgtccagt
aaaatccagccggccccaccagaggaatatgtccctatggtgaaggaagtcggcttggcc
ctgaggacgttattggccactgtggatgagaccattcccctcctaccagccagcacccac
cgagagattgagatggcacagaaactattgaactctgacctgggtgagctcatcaacaag
atgaaactggcccagcagtatgtcatgaccagcctccagcaagagtacaaaaagcaaatg
ctgactgctgctcacgccctggctgtggatgccaaaaacttactcgatgtcattgaccaa
gcaagactgaaaatgcttgggcagacgagaccacactga

DBGET integrated database retrieval system