KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395364Help
Entry
100395364         CDS       T03264                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04140  Autophagy - animal
cjc04144  Endocytosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100395364 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100395364 (TRAF6)
   04064 NF-kappa B signaling pathway
    100395364 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100395364 (TRAF6)
   04140 Autophagy - animal
    100395364 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100395364 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100395364 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100395364 (TRAF6)
   04657 IL-17 signaling pathway
    100395364 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100395364 (TRAF6)
  09158 Development
   04380 Osteoclast differentiation
    100395364 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395364 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100395364 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100395364 (TRAF6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100395364 (TRAF6)
   05152 Tuberculosis
    100395364 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100395364 (TRAF6)
   05162 Measles
    100395364 (TRAF6)
   05161 Hepatitis B
    100395364 (TRAF6)
   05160 Hepatitis C
    100395364 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100395364 (TRAF6)
   05169 Epstein-Barr virus infection
    100395364 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100395364 (TRAF6)
   05140 Leishmaniasis
    100395364 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    100395364 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100395364 (TRAF6)
   04121 Ubiquitin system [BR:cjc04121]
    100395364 (TRAF6)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100395364 (TRAF6)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100395364 (TRAF6)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100395364 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Med21 DUF16 U-box Tropomyosin_1 UPF0242 Spc29 PspA_IM30 DUF1664 Sina ABC_tran_CTD DM
Motif
Other DBs
NCBI-GeneID: 100395364
NCBI-ProteinID: XP_002755232
Ensembl: ENSCJAG00000011070
UniProt: F7ES31
Position
11
AA seq 523 aa AA seqDB search
MSLLNCENSCGSSQSESDCCGAMASSCSAATKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVRCPNEGCLHKMELRHLEDHQVHCEFALMDCPQCQRPFQKCQINIHILK
DCPRRQVSCVNCAASMAFEDKEIHDQNCPLANVVCEYCNTVLIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLTLTPAPPTPEVWNFQETI
HQLEGRLVRQDHQIRELTAKMETQGMYVNELRRTIRTLEDKVAEIEAQQCNGIYIWKIGN
FGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYD
SHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHL
EALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDTGV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtctactaaattgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
ggggccatggccagctcctgtagcgctgcaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcctttatggaggagatccagggatatgatgtggagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacaccgtgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaacgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaggtgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcatcaagtacattgcgagtttgctcttatg
gattgtccccaatgccagcgtcctttccaaaaatgccaaattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgtaaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcgtctgtgaatactgcaatact
gtactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctgcaggagaacacccagtcacacatgagaatgttggcccaggctgttcatagcttg
agccttactttaactcccgctcctcccactcctgaggtctggaatttccaggaaactatt
caccagttagagggtcgccttgtaagacaagaccatcaaatccgagagctgactgctaaa
atggaaactcagggtatgtatgtaaatgagctcaggcgaaccattcgaacccttgaggac
aaagttgctgaaattgaagcacagcagtgcaatggaatttatatttggaagattggcaac
tttggaatgcatctgaaatgtcaagaagaggagaaacctgttgtgattcacagccctgga
ttctacacaggcaaacccgggtataaactgtgcatgcgcttgcaccttcagttaccgact
gctcagcgctgtgcaaactatatatccctgtttgtccacacaatgcaaggagagtatgac
agccacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaa
gcacctgtaagacaaaaccacgaagagataatggatgccaaaccagagctgcttgctttc
cagcgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctg
gaagccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtc
tccacccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgat
acaggagtgtag

DBGET integrated database retrieval system