KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395399Help
Entry
100395399         CDS       T03264                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04062  Chemokine signaling pathway
cjc04140  Autophagy - animal
cjc04270  Vascular smooth muscle contraction
cjc04621  NOD-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04722  Neurotrophin signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04915  Estrogen signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100395399 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100395399 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    100395399 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    100395399 (PRKCD)
   04062 Chemokine signaling pathway
    100395399 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100395399 (PRKCD)
   04915 Estrogen signaling pathway
    100395399 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100395399 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100395399 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100395399 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100395399 (PRKCD)
   04931 Insulin resistance
    100395399 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100395399 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100395399 (PRKCD)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100395399 (PRKCD)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100395399 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like C1_2 zf-RING-like Zf_RING Haspin_kinase zf-RING_9 PHD Pkinase_fungal DUF2318 DZR APH FYVE_2
Motif
Other DBs
NCBI-GeneID: 100395399
NCBI-ProteinID: XP_002758472
Ensembl: ENSCJAG00000007197
UniProt: F6ZHC0
Position
15
AA seq 676 aa AA seqDB search
MPPFLRISFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVSQRASR
RSDSASSEPVGIYQGFEKKTGVSGEDSLDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFERDPPKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgccgccattcctgcgcatctccttcaactcctacgagctgggctccctgcaggccgag
gatgaggcgaaccagcccttctgtgccgtgaagatgaaggaggcactcagcacagagcgt
gggaaaacactggtgcagaagaagccgaccatgtatcctgagtggaagtcaacatttgac
gcccacatttacgagggccgcgtcatccagattgtgctaatgcgggcagccgaggagcct
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaacggg
aaggccgagttctggctggacctgcagccccaggccaaggtgttgatgtctgtgcagtat
ttcctggaggacgtggattgcaaacagtctatgcgtagtgaggacgaggccaagttccca
acgatgaaccgccgtggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgcactggcactgcggccaacagccgggacaccatattc
cagaaagaacgcttcaacatcgacatgcctcaccgcttcaaggtttacaactacatgagc
cccaccttctgcgaccactgtggcagcctgctctggggattggtgaagcagggattaaag
tgtgaagactgcggcatgaatgtgcaccataagtgccgggagaaggtggccaacctctgc
ggcatcaaccagaagctcttggccgaggccttgaaccaagtctcccagagagcctcccgg
agatcagactcagcctcctcagagcctgttgggatataccagggtttcgagaagaagact
ggagtctctggggaggactcactagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttc
gggaaggtgctgcttggagagctgaagggcaggggagagtactttgccatcaaggccctc
aagaaggatgtggtgctgatcgatgacgatgtggaatgcaccatggtagagaagcgggtg
ctgacgctcgccgcggagaacccctttctcacgcacctcatctgtaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaatgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgcagcggagatcatctgtgga
ctgcagtttctacacagcaagggcatcatttatagggacctcaaactggacaatgtgctg
ctggaccgggatggccacatcaagattgctgactttgggatgtgcaaagagaacatattc
ggggagaaccgggccagcaccttctgtggcacccctgactacattgcccctgagatccta
cagggcctgaagtacacattctctgtggactggtggtcttttggggtccttctctacgag
atgctcattggccagtcccccttccatggtgacgatgaggatgaactctttgagtccatc
cgtgtggacacgccgcattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggacccacccaagaggctcggagtgaccggaaatatcaaaatccat
cccttcttcaagaccataaactggactctgctggaaaagcggaggttggagccgcccttc
aggcccaaagtgaagtcccccagagactacagcaacttcgaccaagagttcctgaacgag
aaggcacgcctctcctacagcgacaagaacctcattgactccatggaccagtcggccttt
gccggcttctcctttgtgaaccccaaatttgagcacctcctggaagattga

DBGET integrated database retrieval system