KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395403Help
Entry
100395403         CDS       T03264                                 

Gene name
IL12B, IL-12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04620  Toll-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04940  Type I diabetes mellitus
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100395403 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100395403 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100395403 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100395403 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100395403 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100395403 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395403 (IL12B)
   05205 Proteoglycans in cancer
    100395403 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100395403 (IL12B)
   05330 Allograft rejection
    100395403 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100395403 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100395403 (IL12B)
   05134 Legionellosis
    100395403 (IL12B)
   05152 Tuberculosis
    100395403 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    100395403 (IL12B)
   05164 Influenza A
    100395403 (IL12B)
   05168 Herpes simplex virus 1 infection
    100395403 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100395403 (IL12B)
   05145 Toxoplasmosis
    100395403 (IL12B)
   05140 Leishmaniasis
    100395403 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    100395403 (IL12B)
   05143 African trypanosomiasis
    100395403 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100395403 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100395403 (IL12B)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100395403 (IL12B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100395403 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_5 Ig_2 Ig_3 fn3 Ig_4
Motif
Other DBs
NCBI-GeneID: 100395403
NCBI-ProteinID: XP_002744154
Ensembl: ENSCJAG00000019062
Position
2
AA seq 328 aa AA seqDB search
MCHQRLVISWFSLVLLASPLVAIWELKKDVYVIELDWYLDAPGEMVVITCDTPEEDGITW
TLEESSEVLGSGKNLTIQVKEFGDAGQYTCHKGGEALSHLLLLLHKKEDGVWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPRGVMCGAPVLSAERV
RADGKEYEYSVECQEDSACPAAEERLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRVFMDKTSATVIC
RKNASVSVQAQDRYYSSSWSEWASVPCN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaccagcggctggtcatctcttggttttccctggttttgctagcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcatagaattggattggtacctggat
gcccccggagaaatggtggttatcacctgtgacacccctgaagaagatggtatcacctgg
accttggaggagagcagtgaggtcttaggctcgggcaaaaacctgaccatccaagtcaaa
gagtttggagatgctggccaatatacctgccacaaaggaggcgaggctctgagccatttg
cttctgctgcttcacaaaaaggaagacggagtttggtccaccgatatattaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaggccaagaattattctggacgtttc
acctgctggtggctgacaacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttccgacccccgaggggtgatgtgtggagcacctgtgctctctgcagagagggtc
agagcggacggcaaggagtatgagtactcggtggagtgtcaggaggacagtgcctgccca
gccgctgaggagaggctgcccattgaggtcgtggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaagcctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acatggagtacaccacattcctacttctccctgacattctgcattcaggtccagggcaag
agcaagagggaaaagaaagatagagtcttcatggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcgttagcgtgcaggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcaattag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406669Help
Entry
100406669         CDS       T03264                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04620  Toll-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04940  Type I diabetes mellitus
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05162  Measles
cjc05164  Influenza A
cjc05168  Herpes simplex virus 1 infection
cjc05200  Pathways in cancer
cjc05321  Inflammatory bowel disease (IBD)
cjc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100406669 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100406669 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100406669 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100406669 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100406669 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100406669 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100406669 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    100406669 (IL12A)
   05330 Allograft rejection
    100406669 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100406669 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100406669 (IL12A)
   05134 Legionellosis
    100406669 (IL12A)
   05152 Tuberculosis
    100406669 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    100406669 (IL12A)
   05164 Influenza A
    100406669 (IL12A)
   05168 Herpes simplex virus 1 infection
    100406669 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100406669 (IL12A)
   05144 Malaria
    100406669 (IL12A)
   05145 Toxoplasmosis
    100406669 (IL12A)
   05140 Leishmaniasis
    100406669 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    100406669 (IL12A)
   05143 African trypanosomiasis
    100406669 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100406669 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100406669 (IL12A)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100406669 (IL12A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100406669 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12
Motif
Other DBs
NCBI-GeneID: 100406669
NCBI-ProteinID: XP_008981813
Ensembl: ENSCJAG00000000431
Position
17
AA seq 312 aa AA seqDB search
MPSRWKLSNACLFLTLSAANPAGRRGRTCHREADVEREREKARDQSPGKVLPRLETVIKL
WPPGSALQPPPSPAAATGLHPAARPVSLQCRPSMCPARSLLLVATLVLLDCLSLARNLPM
ATPDPGMFPCLHHSQTLLRAVSNMLQKARQTLKFYPCTSEEIDHEDITKDKTSTVEACLP
LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKAMNAKLLM
DPKRQIFLDQNMLAVIDKLMQALNFNSETVPQKSSLEEPDFYRTKTKLCILLHAFRIRAV
TIDRVISYLHVA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccgctggaagctgtccaatgcctgcttgtttttaacactcagcgccgcaaac
cccgcgggccggcggggccgcacgtgtcaccgagaagctgatgtagagagagagagagag
aaagcaagagaccagagtcccgggaaagtcctgccgcgcctcgagacagttataaaattg
tggccccctgggtcagccttgcagccacctccctcacctgccgcggccacaggtctgcat
ccagcggctcgcccagtgtccctgcagtgccggcccagcatgtgtccagcgcgcagcctc
ctccttgtggccactctggtcctcctggactgcctcagcttggccagaaacctccccatg
gccaccccagacccaggaatgttcccgtgccttcaccactcccaaaccctgctaagggcc
gtcagcaacatgctccagaaggccagacaaactctaaaattttacccttgcacttctgaa
gagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgcttacca
ttggaattaaccaagaatgagagttgcctaaattccagagagacctcttttataactaac
gggagttgcctggcctccagaaaaacctcttttatgatggccctgtgccttagtagtatt
tatgaagacttgaagatgtaccaggtggagttcaaggccatgaatgcaaagcttctgatg
gatcctaagaggcagatctttctagatcaaaacatgctggcagttattgacaagctgatg
caggccctgaatttcaacagtgagactgtgccacaaaagtcctcccttgaagaaccggat
ttttatagaactaaaaccaagctctgcatacttcttcatgctttcagaattcgggcagtg
accattgatagagtgataagctatctgcatgttgcctaa

DBGET integrated database retrieval system