KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395583Help
Entry
100395583         CDS       T03264                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00280  Valine, leucine and isoleucine degradation
cjc00410  beta-Alanine metabolism
cjc00640  Propanoate metabolism
cjc01100  Metabolic pathways
cjc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100395583 (HIBCH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100395583 (HIBCH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100395583 (HIBCH)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100395583 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 DUF4600
Motif
Other DBs
NCBI-GeneID: 100395583
NCBI-ProteinID: XP_008997337
Ensembl: ENSCJAG00000005679
UniProt: U3C1G0
Position
6
AA seq 385 aa AA seqDB search
MGQLELWRFMSRFNAFKRTNIILHHLRMSKHTDATEVLLEKKGCAGVITLNRPKVLNTLT
LNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVVSEAEKANQKIAPLFFREE
YMLNNAIGSCQKPYVALLHGITMGGGVGISVHGQFRVATEKCLFAMPETAIGLFPDVGGG
YFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLGVLEEDLLALKSPSKEDVA
AVLENYHTECKIDRDKSFILEEHLDKINSCFSANTMEQIIENLQQDGSSFALEQLKVINK
MSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRALLIDKDRSPKWKP
ADLKEVTDEYLNNHFKSLGSNDLKF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggggcagctggagttgtggaggttcatgtcaaggtttaatgcattcaaaaggactaat
atcatactgcaccatttgagaatgtccaagcacacagatgccacagaagtactattggaa
aaaaaaggctgtgcaggagtcataacactaaacagaccaaaagtgctaaatacattgact
cttaatatgattcggcagatttatccacagctaaagaagtgggaacaagatcctgaaact
ttcctgattattataaagggagctggaggaaaggctttctgtgctgggggtgatatcaga
gtggtctcagaagctgaaaaggcaaaccagaagatagctccacttttcttcagagaagag
tatatgctgaacaatgctattggttcttgccagaaaccttatgttgcacttcttcatgga
attacaatgggtgggggagttggtatttcagtccatgggcaatttcgagtggctacagaa
aagtgtctttttgccatgccagaaacagcaataggactgttccctgatgtgggtggaggt
tatttcttgccacgacttcaaggaaaacttggttacttcctggcattaacaggattcaga
ctaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagactctgaaaag
ttgggcgtgttagaggaagatttgttagccttgaaatctccttcaaaagaagatgttgca
gctgtcttagaaaattaccatacagagtgtaagattgatcgagacaagtcttttatactt
gaggaacacttggacaaaattaacagttgtttttcagccaatactatggaacagattatt
gaaaacttacaacaagatggttcatcttttgccctagagcagttgaaggtaattaataaa
atgtctccaacatctctaaaaatcacactaaggcaactcatggaggggtcttcaaagacc
ttgcaagaagtactaactatggagtatcggctgagtcaagcttgtatgagaggtcatgac
tttcatgaaggcgtcagagctcttttaattgataaagaccggagtccaaaatggaaacca
gctgatctaaaagaagttaccgatgaatatttgaataatcactttaagtctttgggaagc
aatgatttgaaattttga

DBGET integrated database retrieval system