KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395703Help
Entry
100395703         CDS       T03264                                 

Gene name
SLC6A13
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 2
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04721  Synaptic vesicle cycle
cjc04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100395703 (SLC6A13)
   04721 Synaptic vesicle cycle
    100395703 (SLC6A13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100395703 (SLC6A13)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   100395703 (SLC6A13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 100395703
NCBI-ProteinID: XP_009001610
Ensembl: ENSCJAG00000006840
Position
9
AA seq 597 aa AA seqDB search
MDSRVSGTTSNGETKPAYPVMEKKEEDGTLERGHWNNKIEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFLLETALGQYTSQGGITAWRKICPIFEGIGYASQM
IVILLNVYYIIVLAWALFYLFSSFTIDLPWGSCHHEWNTEHCVGFQKTNGSLNGTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRMFRKKNRREVLI
LAVSVISFLVGLVMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGARRFYDNI
EDMIGYRPWPLIKYCWLFVTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMICIPAWSLYRLGTLKGPFRERIHQLVCPAXDLCQWNPAGPLAPXLLRLQELESHC
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggatagcagggtctcaggcacaaccagtaatggagagacaaaaccagcgtatccagtc
atggaaaagaaggaggaagatggcaccctggagcgggggcactggaacaacaagattgag
tttgtgctgtcagtggccggggagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaaaaatgggggaggtgccttcttcatcccctacctcatcttcctgtttacc
tgtggcattcctgtcttccttctggagacagcactaggccagtacactagccagggaggc
atcacagcctggaggaagatctgccccatctttgagggcattggctatgcctcccagatg
atcgtcatcctcctcaacgtctactacatcattgtgctggcctgggcccttttctacctc
ttcagcagcttcaccatcgacctgccctggggcagctgccaccatgagtggaacacagaa
cactgtgtggggttccagaagaccaacggctccctgaatggtacttctgagaacgccacc
tcccctgtcatcgagttctgggagcggcgggtcttgaagatctctgatgggatccagcac
ctgggggccctgcgctgggagctggccctgtgcctcctgctggcctgggtcatctgctac
ttctgcatctggaagggggtcaagtccacaggcaaggtggtgtacttcacagccacattt
ccttacctcatgctggtggtcctgttaattcgaggggtgacgctgcccggggcagcccaa
ggaattcagttttacctgtacccaaacctcacgcgtctgtgggatccccaggtgtggatg
gatgcgggcacccagatcttcttctctttcgccatctgtcttgggtgcctgacagccctg
ggcagctacaacaaataccacaacaactgctacagggactgcattgccctctgcttcctc
aacagcggcaccagctttgtggccgggtttgccatcttctccattctgggcttcatgtcg
caggagcagggggtgcccatttctgaggtggccgagtcaggtcctggtctggctttcatc
gcctacccgcgggctgtggtgatgctgccgttctctcctctctgggcctgctgtttcttc
ttcatggttgttctcctgggactggatagccagtttgtgtgcgtagaaagcctggtgact
gcgctggtggacatgtacccccgcatgtttcgcaagaagaaccggagagaagtcctcatc
cttgcagtgtctgtcatctccttccttgtggggctggtcatgctcacagagggcggcatg
tacgtgttccagctctttgactactacgccgccagcggcatgtgcctcctgttcgtggcc
atctttgagtccctctgtgtggcttgggtttacggagccaggcgcttctacgacaacatc
gaagacatgattggctacaggccgtggccgcttatcaaatattgttggctcttcgtcaca
ccagctgtgtgcacagccaccttcctcttctccctgatcaagtacactccgctgacctac
aacaagaagtacacgtacccatggtggggcgatgccctgggctggctcctggctctgtcc
tccatgatctgcattcctgcctggagcctctacagactcggcaccctcaagggccccttc
agagagagaatccatcagcttgtgtgcccagctngggacctatgccagtggaacccagca
ggacccttggctcctnngctgctcagactccaagagcttgagtctcactgctaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411005Help
Entry
100411005         CDS       T03264                                 

Gene name
SLC6A11
Definition
(RefSeq) solute carrier family 6 member 11
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04721  Synaptic vesicle cycle
cjc04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100411005 (SLC6A11)
   04721 Synaptic vesicle cycle
    100411005 (SLC6A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100411005 (SLC6A11)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   100411005 (SLC6A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 100411005
NCBI-ProteinID: XP_008980399
Ensembl: ENSCJAG00000016541
UniProt: U3EZ69
Position
15
AA seq 632 aa AA seqDB search
MTAEKALPLGNGKAAEETRESEAPGGGGGSGGAAAARDPRDKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYQPLSLIKWCWKIVTPGICAGIFIFFLVKYKPLKY
NNVYTYPAWGYGIGWLMALSSMLCIPLWICIKMWKTEGTLPEKLQTLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggagaaggcgctgcccctgggcaatgggaaggctgccgaggagacgcgggag
tccgaggcgccgggtggcggcggcggcagcgggggtgcggcggccgcgcgcgacccgcgc
gacaagcgcgacaaggcggtccacgagcgcggccactggaacaacaaggtggagttcgtg
ctgagcgtggccggggagatcattggactgggcaacgtgtggcgcttcccctacctgtgc
tacaagaacggaggaggggcgttcctgattccctatgtggtgttttttatttgctgtgga
attcctgtttttttcctggagacagctctgggacagttcacgagtgaaggtggcattacg
tgttggaggaaagtttgccctttatttgaaggcattggctatgcaacgcaagtgattgag
gcccatctgaatgtgtactacatcatcatcctggcatgggccattttttacctgagcaac
tgcttcactactgagctaccctgggctacctgtgggcatgagtggaacacagagaattgt
gtggagttccagaaactgaatgtgagcaactacagccatgtgtctctgcagaatgccacc
tcccccgtcatggagttttgggagcgccgggtcctggccatctctgatgggatcgagcac
atcgggaatctccgctgggagctggccttgtgtctcctggcagcctggaccatctgttac
ttctgtatctggaaggggaccaagtctacaggaaaggttgtgtacgtgactgcaacattc
ccctacatcatgctgctgatcctcctgatacgaggggtcacattgcccggggcctcagag
ggcatcaagttctacttgtaccctgatctttcccggctctctgacccacaggtctgggta
gatgctggaacgcagatctttttctcctatgccatttgcctgggctgtctgaccgctctg
ggaagttataacaattataacaacaactgctacagggactgcatcatgctctgttgcctg
aacagcggcaccagcttcgtggctgggtttgccatcttctcggtcctgggttttatggcg
tatgagcagggggtacccattgctgaggtggcagagtcaggccccggcctggcctttatt
gcgtaccccaaggcggtcaccatgatgcctctctccccactgtgggccaccttgttcttc
atgatgctcatcttcctgggactggacagccagtttgtgtgcgtggaaagcctggtgact
gccgtagtggacatgtaccccaaggtcttccgaaggggttaccggcgggagctgctcatc
ctagccttgtctgttatctcctattttctgggccttgtgatgttaacagagggtggcatg
tacatcttccagctctttgactcctacgctgccagtgggatgtgccttctcttcgtggcc
atctttgagtgcatctgcatcggctgggtgtatggaagcaaccggttctatgataacatt
gaagacatgattggctaccagccactgtcgctcattaagtggtgctggaagatcgtgacg
cctggaatctgtgcggggatcttcatcttcttcttggtcaagtacaagccgctcaagtac
aacaacgtctacacctacccggcctggggctacggcatcggctggctcatggccctgtcc
tccatgctctgcatcccgctctggatctgcatcaagatgtggaagacagaggggacactg
cctgagaaactccagacgttgacgacccccagcacagatctgaaaatgcggggcaagctt
ggggtgagcccacggatggtgacagttaatgactgtgacgccaaactcaagagtgacggg
accatcgcagccatcacagagaaggagacgcacttctga

DBGET integrated database retrieval system