KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395730Help
Entry
100395730         CDS       T03264                                 

Gene name
SLC18A2
Definition
(RefSeq) solute carrier family 18 member A2
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04721  Synaptic vesicle cycle
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100395730 (SLC18A2)
   04726 Serotonergic synapse
    100395730 (SLC18A2)
   04721 Synaptic vesicle cycle
    100395730 (SLC18A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100395730 (SLC18A2)
  09165 Substance dependence
   05030 Cocaine addiction
    100395730 (SLC18A2)
   05031 Amphetamine addiction
    100395730 (SLC18A2)
   05034 Alcoholism
    100395730 (SLC18A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100395730 (SLC18A2)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC18: Vesicular amine transporter
   100395730 (SLC18A2)
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    100395730 (SLC18A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 S_4TM LacY_symp
Motif
Other DBs
NCBI-GeneID: 100395730
NCBI-ProteinID: XP_002807513
Ensembl: ENSCJAG00000019511
Position
12
AA seq 501 aa AA seqDB search
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVLTASNSDSFESIFSYYDNSTMVTRNATRDLQEGQLHQTTTQHMVANRSAVPSDC
PSEDKDLLNENVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFA
FSSSYALLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPP
FGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIA
AGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGR
WLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSV
YGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKE
EKMAILMDPKCPIKTKNVHSE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagcgagctggcgctggtccgctggctgcaggagagccgccgctcacggaag
ctcatcctgttcatcgtgttcctggcgctgctgctggacaacatgctgctcaccgttgtg
gtccctatcatcccaagttatctgtacagcattaagcatgagaagaatgctacagagatc
cagacggccaggccagtgctcacagcctccaactccgacagcttcgagagcatcttctcc
tattatgacaactctaccatggtcaccaggaacgctaccagagacctgcaggaggggcag
ctgcatcagaccactacacagcacatggtggccaacaggtctgctgtcccttccgactgt
cccagcgaagacaaagacctcctgaatgaaaacgtgcaagttggtctgttgtttgcctcg
aaagccactgtccagctccttaccaaccctttcataggactgctgaccaacagaattggc
tatccaattcctatatttgcaggattctgcatcatgtttgtctcaacaattatgtttgcc
ttctccagtagctatgccctcctgctgatcgccaggtcgctgcaggggatcggctcatcc
tgctcctctgtggccgggatgggcatgcttgccagtgtctacacagatgatgaagagaga
ggcaacgccatgggaatcgccttgggaggcctggccatgggggtcttagtgggccccccc
ttcgggagtgtgctctacgagtttgtggggaagacagctccattcctggtgctggctgcc
ttggtactcttggatggagctattcagctctttgtgctccagccgtcccgggtgcagcca
gagagtcagaaggggacacccctaaccacgctgctgaaggacccgtacatcctcattgct
gcaggctccatctgctttgcaaacatgggcatcgccatgctggagccagccctgcccatc
tggatgatggagaccatgtgttcccgaaagtggcagctgggcgttgctttcttgccagct
agtatctcttatctcattggaaccaatatttttgggatacttgcacacaaaatggggagg
tggctttgtgcccttctaggaatgataattgttggagtcagcattttatgtattccattt
gcaaaaaacatttatggactcatagctccgaactttggagttggttttgcaattggaatg
gtggattcatcaatgatgcccatcatgggctacctcgtagacctgcggcacgtgtctgtc
tatgggagtgtgtacgctattgcagatgtggcattttgtatggggtacgctataggccct
tctgctggtggtgctattgcaaaggcaattggatttccatggctcatgacaattattgga
ataattgatattctttttgctcctctctgcttttttcttcgaagtccacctgccaaagaa
gaaaaaatggctattctcatggatcccaagtgccctattaaaacaaaaaatgtacactca
gaataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405909Help
Entry
100405909         CDS       T03264                                 

Gene name
SLC18A1
Definition
(RefSeq) solute carrier family 18 member A1
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04721  Synaptic vesicle cycle
cjc04726  Serotonergic synapse
cjc04728  Dopaminergic synapse
cjc05012  Parkinson disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100405909 (SLC18A1)
   04726 Serotonergic synapse
    100405909 (SLC18A1)
   04721 Synaptic vesicle cycle
    100405909 (SLC18A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100405909 (SLC18A1)
  09165 Substance dependence
   05030 Cocaine addiction
    100405909 (SLC18A1)
   05031 Amphetamine addiction
    100405909 (SLC18A1)
   05034 Alcoholism
    100405909 (SLC18A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cjc02000]
    100405909 (SLC18A1)
Transporters [BR:cjc02000]
 Solute Carrier Family (SLC)
  SLC18: Vesicular amine transporter
   100405909 (SLC18A1)
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    100405909 (SLC18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 100405909
NCBI-ProteinID: XP_017819209
Ensembl: ENSCJAG00000014369
Position
13
AA seq 525 aa AA seqDB search
MLRTVLNASQGLLKEGRESRQLVLVVVFVALLLDNMLLTVVVPIVPTFLYAMEFKEVNSS
LYLGRAGSSPQALTFPAFSTIFSLFDNNTVAVEESVPNGTAWMNGTASTVPPAATEAIAA
HKNNCLQGTGFLEEENTRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFIIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDYERGQAMGIALGGLALGV
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFILLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFWCVG
NKMGRWLCSLIGMLVVGSSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAVGPSIGGAIVQAIGFPWLMVIIGVVNIIYAPLCYYLRS
PPAKEEKLAILSQECPMETRMYATQKPVKEFPLGEDSDEETDREE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctccggactgttctgaacgcttcccaggggttgctgaaggagggaagagagtctcgg
cagctggtgctggtggtggtatttgtcgctctgctcctggacaacatgctgcttactgtg
gtggtgccaattgtgccaaccttcctatatgccatggagttcaaagaagtcaactcttct
ctgtaccttggtcgtgccggaagttccccacaggccctcacctttcctgccttttccacc
atcttctccctctttgacaacaacaccgtagctgttgaagaaagcgtgcccaatggcaca
gcatggatgaatggcactgccagcaccgttccccctgcagccaccgaagccatcgcagct
cataaaaacaactgcttgcaaggcacaggattcctggaggaagagaatacccgggtcggg
gttctgtttgcttcaaaggctgtgatgcaacttctggtcaacccattcgtgggccctctg
accaacaggattggatatcatatccccatgtttgctggcttcattatcatgtttctctcc
acagttatgtttgctttttctggaacctatactctactctttgtggctcgaacccttcaa
ggcattggatcttctttttcatctgttgcaggtcttgggatgctggccagcgtctacacc
gatgactatgagagaggacaggccatgggaatcgcgctggggggcctggccctgggagtg
ctggtaggagcgccctttggaagtgtaatgtatgagtttgttgggaagtctgcgccgttc
ctcatcctggccttcctggcactactggatggagcactccagctttgcatcctacagcct
tccaaagtctctcctgagagtgccaaggggactccgctctttatacttctcaaagaccct
tacatcctggtggctgcagggtccatatgctttgccaacatgggagtggccatcctggag
cccacactgcccatctggatgatgcagaccatgtgctcccccaagtggcagctgggtcta
gctttcttgccagccagtgtgtcctacctcatcggcaccaacctcttttggtgtgttggc
aacaagatgggtcggtggctgtgttccctaatcgggatgctggtagtaggtagcagcttg
ctttgtgttcctctggctcacaacatttttggtctcattggacccaatgcagggcttggc
cttgccataggcatggtggattcctctatgatgcccatcatgggacacctggtggatcta
cgccacacctcagtgtatgggagtgtctatgccatcgctgatgtggctttttgcatgggc
tttgctgtaggtccatccattgggggtgccattgtgcaggccattggtttcccctggctc
atggtcatcattggggtcgtcaacatcatctatgctccactctgctactacctgcggagc
cccccagccaaggaggagaagcttgctattctgagtcaggagtgccccatggagacccgg
atgtatgcaacccagaagcctgtgaaggaatttcccctgggggaggacagtgatgaagag
actgaccgtgaggagtag

DBGET integrated database retrieval system