KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395856Help
Entry
100395856         CDS       T03264                                 

Definition
(RefSeq) dual specificity protein kinase TTK-like
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100395856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100395856
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100395856
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100395856
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  TTK family
   100395856
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100395856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo RIO1 APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 100395856
NCBI-ProteinID: XP_017832051
Position
9
AA seq 420 aa AA seqDB search
MSAYKWYDPKSICKTPSSNALDDYMSCFRTPVTKNDFPLACQLSTPYGQPVCFQQQQQQI
PATPLQTLQVLASSSTNECISVKGKIYSILKQIGCGGSSNIFQVLNEKKQIYAIKYVNLE
EADNQTLDSYQNEIVYLNKLQQHSDKIIRLYDYEFTDQYIYMVMECGNIDLNCWLKKKKS
IDPWERNSYWKNMLEAVHTIHQYGIVHNDLKPANFLIVGGMLKLIDFXIANQMQPDTSIV
KDSQVGTVNYMPPEVIKDMSSSRENGKSKSKISPKXDVWSLGCILYYMTYGKTPFQHIIN
QISKLHAIIDPNHEIEFPDIPEIDLQDVLKCCLIRDPKQKISIPELLAHACIQIQTHPGK
QIAKETTEYVLGQLVGLNSPNSILKAAKTLYEQYSGGESHNSSSSKTVEKSRKKMICSYW
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttataaatggtatgatccaaaatctatttgtaagacaccaagcagcaatgcc
ttggatgattacatgagctgttttagaactccagttacaaagaacgactttccacttgct
tgtcagttgtcaacaccttatggccaacctgtctgtttccagcagcaacagcagcaaata
cctgctactccacttcaaactttacaggttttagcatcctcttcaacaaatgaatgcatt
tcagttaaaggaaaaatttattccatattaaagcagataggatgtggaggttccagtaac
atatttcaggttttgaatgaaaagaaacagatatatgctataaaatatgtgaacttagaa
gaagcagataaccaaactcttgatagttaccagaacgaaatagtttatttgaataaacta
caacaacacagtgataaaatcatccggctttatgattatgaattcacagaccagtacatc
tacatggtaatggagtgtggaaatattgatcttaattgttggcttaaaaagaaaaaatcc
attgacccatgggaacgcaacagttactggaaaaatatgttagaggcagttcatacaatc
catcaatatggcattgttcacaatgatcttaaaccagctaactttctgatagtgggtgga
atgttaaagctaattgattttnngatcgcaaaccaaatgcaaccagatacaagtattgtt
aaagattctcaggttggcacagttaattatatgccaccagaagtgatcaaagatatgtct
tcctccagagagaatgggaaatctaagtcaaagataagccccaaangtgatgtttggtcc
ttaggatgtattttgtactatatgacttacggcaagacaccatttcagcatataattaat
cagatttctaaattgcatgccataattgatcctaatcatgaaattgaatttcctgatatt
ccagagatagatcttcaagatgtgttaaagtgttgtttaataagggaccctaaacagaag
atatccattcctgagctcctggctcatgcatgcattcaaattcaaactcatccaggtaaa
caaatagccaaggaaaccactgaatatgttcttggccaacttgttggtctgaattctcct
aactctattttgaaagctgctaaaactttatatgaacagtatagtggtggagaaagtcat
aattcttcatcatccaagactgttgagaaaagtaggaaaaaaatgatttgtagttactgg
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401852Help
Entry
100401852         CDS       T03264                                 

Gene name
TTK
Definition
(RefSeq) TTK protein kinase
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100401852 (TTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100401852 (TTK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100401852 (TTK)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100401852 (TTK)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: Other
  TTK family
   100401852 (TTK)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100401852 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo APH RIO1 Mad3_BUB1_I_2 Mad3_BUB1_I Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100401852
NCBI-ProteinID: XP_017827114
Ensembl: ENSCJAG00000010886
Position
4
AA seq 856 aa AA seqDB search
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLSDVLLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNFNKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKTLSSSTVLTAQESFSSSLGHLQNRINSCDSRGQATKARF
LYGENMPPQDAEIGSRNPLKQTNKTKQSCPFGRVPVNLLNSPDCDAKRDDSVVPSFIKRQ
ISRSGCRDLVVPGSKPSGNDSCELRNLKSVQNIHFKEPLMSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWESKRKSECINQNPAASSNQWQIPELARKINTEK
HTTFEQPVFSVSKQSPPMSAYKWYDPKSICKTPSSNALDDYMSCFRTPVIKNDFPPACQL
STPYGQPVCFQQQQQQIPATPLQTLQVLAASSTNECISVKGKIYSILKQIGRGGSSKVFQ
VLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMV
MECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLK
LIDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLG
CILYYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEIDLQDVLKCCLIRDPKQRIS
IPELLAHAYVQIQTHPGKQIAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEQYSGGES
HNSSSSKTIEKKWEKK
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgagctaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggctgaatttgttgctcaaactagagaaaaacagtgttcctctaagt
gatgttcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttcctcca
gataaatacggccaaaatgagagttttgctagaattcaagtcagatttgctgaattaaaa
gctattcaggaaccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatttcaac
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgcta
gaaattgccctccggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagactttatcatcatctacggtattaactgcccaagaatcattttccagttcacttggg
catttacagaataggatcaacagttgtgattccagaggacaggctactaaagccaggttt
ttatatggagagaacatgcccccacaagatgcagaaataggttctcggaatccattgaaa
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagattgtgatgcgaagagagatgattcagttgtaccaagttttataaaaagacag
atctctagatcaggatgcagagatttggttgtgcctggatctaaaccaagtggaaatgat
tcctgtgaattgagaaatttaaagtctgttcaaaatattcatttcaaagaacctttgatg
tcagatgaaaagagttctgaacttattattactgattcaataactctgaagaataaaact
gaatcaagtcttctagctaaattagaagaaactaaagagtaccaagaaccagaggttcca
gagagtaaccagaaacagtgggaatctaagagaaagtcagagtgtattaaccagaatcct
gctgcatcttcaaatcagtggcagattccagagttagcccgaaagattaatacagagaaa
cataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccgccaatgtcagct
tataaatggtatgatccaaaatctatttgtaagacaccaagcagcaatgccttggatgat
tacatgagctgttttagaactccagttataaagaacgactttccacctgcttgtcagttg
tcaacaccttatggccaacctgtctgtttccagcagcaacagcagcaaatacctgctact
ccacttcaaactttacaggttttagcagcctcttcaacaaatgaatgcatttcagttaaa
ggaaaaatttattccatattaaagcagataggacgtggaggttccagtaaggtatttcag
gttttgaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagcagat
aaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaacac
agtgataagatcatccggctttatgattatgaaatcacagaccagtacatctacatggta
atggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgaccca
tgggagcgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaacat
ggcattgttcacagtgatcttaaaccagctaactttctgatagtggatggaatgttaaag
ctaattgattttgggatcgcaaaccaaatgcaaccagatacaacaagtattgttaaagat
tctcaggttggcacagttaattatatgccaccagaagcgatcaaagacatgtcttcctcc
agagagaatgggaaatctaagtcaaagataagtcccaaaagtgatgtttggtccttagga
tgtattttgtactatatgacttatggcaagacaccatttcagcatataattaatcagatt
tctaaattgcatgccataattgatccaaatcatgaaattgaatttcctgatattccagag
atagatcttcaagatgtgttaaagtgttgtttaataagggaccctaaacagaggatatcc
attcctgagctcctggctcatgcatacgttcaaattcaaactcatccaggtaaacaaata
gccaagggaaccactgaagaaatgaaatatgttcttggccaacttgttggtctgaattct
cctaactctattttgaaagctgctaaaactttatatgaacagtatagtggtggtgaaagt
cataattcttcatcatccaagactattgaaaaaaagtgggaaaaaaaatga

DBGET integrated database retrieval system