KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395878Help
Entry
100395878         CDS       T03264                                 

Gene name
PYCARD
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04625  C-type lectin receptor signaling pathway
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100395878 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100395878 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    100395878 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    100395878 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100395878 (PYCARD)
   05133 Pertussis
    100395878 (PYCARD)
   05134 Legionellosis
    100395878 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    100395878 (PYCARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN SpoIIIAC Ribosomal_L32e
Motif
Other DBs
NCBI-GeneID: 100395878
NCBI-ProteinID: XP_017818835
Position
12
AA seq 180 aa AA seqDB search
MATLRPLVQPKIFKKRIKKFIQHQSDTYVKIKPVDLTDKLVSFYLEAYCAELAATVLRDM
GLQEMAGQLQEATQQGSGAAPAGIRAPPQPAAKPGQHFIDLHRAALIARVTEVEGLLDAL
YAKVLTEEQYQAVRAEPTNPTKMRKLFSFTPAWNWNCKDLFLQALRETQSYLVEDLEQKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccaccctcagaccccttgtgcagcccaagatcttcaaaaagagaatcaaaaagttc
atccagcaccagtcagacacatatgtcaaaattaagcccgtggacctcaccgacaagctg
gtcagcttctacctggaggcctactgcgccgagctcgcggcgactgtgctgcgggacatg
ggcctgcaggagatggccgggcagctgcaggaggccacgcagcagggctctggagccgcg
ccagctgggatccgggcccctcctcagccagcagccaagccaggccagcactttatagac
ctgcacagggctgcgcttatcgcgagggtcacagaggttgaggggctgctggatgccctt
tacgcgaaggtcctgacggaggagcagtaccaggcagtgcgagccgagcccaccaaccca
accaagatgcggaagctcttcagcttcacgccagcctggaactggaactgcaaggacttg
ttcctccaggccctgagggagacccagtcctacctggtggaagacctggagcagaagagc
tga

DBGET integrated database retrieval system