KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395977Help
Entry
100395977         CDS       T03264                                 

Gene name
TNFRSF10A
Definition
(RefSeq) TNF receptor superfamily member 10a
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100395977 (TNFRSF10A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100395977 (TNFRSF10A)
   04217 Necroptosis
    100395977 (TNFRSF10A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100395977 (TNFRSF10A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100395977 (TNFRSF10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100395977 (TNFRSF10A)
   04090 CD molecules [BR:cjc04090]
    100395977 (TNFRSF10A)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100395977 (TNFRSF10A)
CD molecules [BR:cjc04090]
 Proteins
  100395977 (TNFRSF10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6
Motif
Other DBs
NCBI-GeneID: 100395977
NCBI-ProteinID: XP_008977433
Position
13
AA seq 377 aa AA seqDB search
MRQPRPCAQAPSRARAGRAPGPRRARGARPRLRVPQIFFSVVVVGVLLWAVPASAVTIKR
DDQLPASQQWKHSPPGEVCPPEYFQLEPSGDCNQYMAGGGYPNESNNLPSCCPCRVCKSD
EEELSPCTTTRNRVCQCNPGTFREEDSPEMCRKCSVRCPSGMVPVSDCTPQSDISCEEKS
GNGPDAWMILLIVVLPLFVPILIIYWCIRSGRGRDSRCMDSVRSFCWWPLRGPEAKDNDH
NEILSNADSMSTLASEEPVESQEPADLTDVIVQSPGEAQSLLRLAENKGSQRTRLLVLPN
GADPTEALRQCFHHFTDNVPFNSWVPFARELGLTENEICVARAEAAGPSDALYVMLTKWV
NKTGRNASIHTLLKALE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagacagccgagaccctgcgcccaggctccctcgagggcccgggcagggcgcgcccca
ggacccaggcgggcgcgaggagcgaggccccggctccgagtcccccagattttcttctcc
gtcgtcgtcgtcggggtcttgctgtgggctgtacctgcctcagctgtaaccatcaaacgt
gatgatcaattacctgcctcacagcaatggaaacatagccctccgggagaagtgtgccca
ccagaatatttccaattagaacccagtggagattgtaaccagtacatggctggtggaggt
taccccaatgagtccaacaacttgccttcttgctgcccatgtagagtttgtaaatcagat
gaagaagagctaagtccctgcaccacgaccaggaacagagtgtgtcagtgcaacccaggc
accttccgggaagaagattcccctgagatgtgtcgtaaatgcagcgtacggtgccccagt
gggatggttccagtcagtgattgtacgccacagagtgacatcagctgtgaagaaaaatca
ggcaatggacctgatgcatggatgattttactcatagttgtgttgcctctgtttgtgccc
atactgattatctattggtgcatccgctcaggtcgtggaagagactcccggtgcatggac
agcgtccgttctttctgctggtggcctctacgagggcctgaggctaaggacaatgatcac
aacgagattctgagcaatgcagactcgatgtccactttagcttctgaggagccagtggaa
agccaggagccggcagatttgacagatgtcattgtacagtcccccggggaggcacagtct
ctgctgagactggcagaaaataaagggtctcagaggacaaggctgctggttctcccaaat
ggcgctgaccccactgaggctctgaggcagtgcttccaccactttacagacaacgtgccc
tttaactcctgggtgccgttcgcgagggagctgggcctcacggaaaatgagatctgtgtg
gccagagctgaggcagcgggcccaagtgatgccttgtatgtaatgctgacgaaatgggtc
aacaaaactggacggaacgcctctatccacaccctgctaaaagcgttggag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397442Help
Entry
100397442         CDS       T03264                                 

Gene name
TNFRSF10B
Definition
(RefSeq) TNF receptor superfamily member 10b
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397442 (TNFRSF10B)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100397442 (TNFRSF10B)
   04217 Necroptosis
    100397442 (TNFRSF10B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100397442 (TNFRSF10B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100397442 (TNFRSF10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100397442 (TNFRSF10B)
   04090 CD molecules [BR:cjc04090]
    100397442 (TNFRSF10B)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100397442 (TNFRSF10B)
CD molecules [BR:cjc04090]
 Proteins
  100397442 (TNFRSF10B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death cEGF FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 100397442
NCBI-ProteinID: XP_008977435
Ensembl: ENSCJAG00000020135
Position
13
AA seq 386 aa AA seqDB search
MSGLLTPKTLVLVVVVSVLLSVSADSVPVTQQNLVPQQRAAPQQRFSPTYGLCPPGYHIS
EDGRDCISCQNGQDYTTHWNHVLFCFRCTKCDSGKVEIRSCTTITDTVCQCEEGTFQEED
SPEICRKCSTGCPSGMVKVRDCTPWSDIKCVHKESGIIIGIIALIIFLAVAAYIIWKTSL
WKKVLHYLKGIGSGRGRNLECVDRSSHTRGGPGTEDNVCNESMSILQLIQDSEQEMEVQE
PVVAGDNVSPPREPEHLLEPAETEGSQRRRLLVPANGADPTETLRQCFHHFTDNVPFNSW
VPFARELGLTENEIDVARAEAAGPGDTLYEMLRKWVNKTGRDASVHTLLDALDSLGQRLA
KQKIQDCLVSSGKFVYLEDNADSAIS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcttctcacccccaagacccttgtgctcgtcgtcgtcgtctcggtgctgctg
tcggtctcagctgactctgttccagtcacccaacaaaacctagttccccagcagagagcg
gccccacaacagaggttcagccccacatatggattgtgtccacccggataccatatctca
gaagacggtagagattgtatctcctgccaaaatggacaggactataccactcactggaat
cacgtccttttctgctttcgctgtacaaagtgtgattcaggtaaagtggagataagatcc
tgtaccacaatcacagacacagtgtgtcagtgtgaagaaggcacctttcaggaagaagat
tcccctgagatatgccgcaagtgcagcacagggtgccccagcgggatggtcaaggtcagg
gattgtacgccctggagtgacatcaagtgtgtccacaaagaatcaggcatcatcataggg
attatagctctaatcatattcctggctgtggctgcgtatattatttggaagacttcactg
tggaagaaagtccttcattacctgaaaggcatcggctcaggtcgtggccggaaccttgag
tgtgtagacagaagctcacatacccgaggagggcctgggactgaggacaatgtctgcaat
gaatccatgagtatcttgcagctcatccaggactctgagcaggaaatggaagtccaggag
ccagtggtggcaggtgacaacgtgtcgcccccaagggagccagagcatctgctggaaccg
gcagaaactgaagggtctcagaggaggaggctgctggttccagcaaatggcgctgacccc
actgagactctgaggcagtgcttccaccactttacagacaacgtgccctttaactcctgg
gtgccgtttgcgagggagctgggcctcacggaaaatgagatcgacgtggcgagagctgag
gcagcgggccctggggacaccttgtatgagatgctaagaaagtgggtcaacaaaacgggg
cgggacgcctctgtccacaccctgctggatgccttggattcgctgggacagagacttgca
aagcagaagatccaggattgcctggtgagctccggcaagttcgtgtatctagaagataat
gcagattctgccatctcctga

DBGET integrated database retrieval system