KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396000Help
Entry
100396000         CDS       T03264                                 

Gene name
TNFSF10, TNLG6A
Definition
(RefSeq) tumor necrosis factor superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04068  FoxO signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100396000 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100396000 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100396000 (TNFSF10)
   04217 Necroptosis
    100396000 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100396000 (TNFSF10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100396000 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100396000 (TNFSF10)
   04052 Cytokines and growth factors [BR:cjc04052]
    100396000 (TNFSF10)
   04090 CD molecules [BR:cjc04090]
    100396000 (TNFSF10)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100396000 (TNFSF10)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100396000 (TNFSF10)
CD molecules [BR:cjc04090]
 Proteins
  100396000 (TNFSF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q
Motif
Other DBs
NCBI-GeneID: 100396000
NCBI-ProteinID: XP_002759427
Ensembl: ENSCJAG00000002203
UniProt: F7E747
Position
17
AA seq 281 aa AA seqDB search
MAMMEGQGGPSPGQTCVLILIFTVLLQSLCVAVTYLYFTNELKQMQDKYSKSGIACFLKE
DGSSWDPSDEESMNSPCWEVKWQLRQLVRKMILRTSEETISTVQEKQRGISPQVRERGPQ
RVAAHITGTRGSSNTLPIPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKG
LYYIYCQVYFRFQEEIQENRKNDKQMVQYIYKYTSYPDPILLMKSARNNCWSKDAEYGLY
SIYQGGIFELKENDRIFVSVTNGQLIDMDHEASFFGAFLVG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatggagggtcaggggggacccagcccggggcagacctgcgtgctgatcctg
atcttcacagtgctcctgcagtccctctgtgtggccgtaacttacctgtacttcaccaat
gagctgaagcagatgcaggacaagtactccaaaagcggcattgcttgtttcttaaaagaa
gatggcagctcctgggaccccagtgacgaagagagtatgaatagcccctgctgggaagtc
aagtggcaactccgtcagctcgttagaaagatgattttgagaacctctgaagaaaccatt
tctacagttcaagaaaagcaacgaggtatttctccccaagtgagagaaagaggtcctcag
agagtagcagctcacataactgggaccagaggaagtagcaacacgttgcctattccaaac
tccaagaatgaaaaggctctgggccgcaaaataaactcctgggaatcatcaaggagtgga
cattctttcctgagcaacttgcacttgaggaatggcgagctggtcatccatgaaaaaggg
ctgtattacatctattgccaagtatactttcgatttcaggaggaaatccaagaaaacaga
aagaacgacaaacaaatggtccagtatatttacaaatacacaagttatcctgaccccata
ctgctgatgaagagtgctagaaataattgttggtctaaagatgcagaatatggactctat
tccatctatcaagggggaatatttgagcttaaggaaaacgacagaatttttgtttctgta
acaaatgggcagttgatagacatggaccatgaagccagttttttcggggcctttttagtt
ggctaa

DBGET integrated database retrieval system