KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396072Help
Entry
100396072         CDS       T03264                                 

Gene name
GPHN
Definition
(RefSeq) gephyrin
  KO
K15376  gephyrin [EC:2.10.1.1 2.7.7.75]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00790  Folate biosynthesis
cjc01100  Metabolic pathways
cjc04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100396072 (GPHN)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100396072 (GPHN)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     100396072 (GPHN)
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     100396072 (GPHN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MoCF_biosynth MoeA_N MoeA_C Tubulin-binding
Motif
Other DBs
NCBI-GeneID: 100396072
NCBI-ProteinID: XP_002754063
Ensembl: ENSCJAG00000015520
UniProt: F6VLS8
Position
10
AA seq 769 aa AA seqDB search
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSL
NVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVH
DELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAI
AAKKHPFYTSPAVVMAHGEQPIPGLINYSHHSADERIPDSIISRGVQVLPRDTASLSTTP
SESPRAQATSRLSTASCPTPKVQSRCSSKENILRASHSAVDITKVARRHRMSPFPLTSMD
KAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDR
FIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRI
LVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVEVNKFPVVAVMSTG
NELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADV
IITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGN
PVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYHRCILTWHHQEPLP
WAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYVELHKGEVVDVMVIGRL
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgagggaatgatcctcactaaccacgaccatcaaatccgtgtcggagtcctc
acagtgagtgatagttgcttcaggaatcttgcggaagatcgcagtgggataaatctcaaa
gatctcgtacaagatccttctttgttgggtgggactatatcagcatacaagatagtacca
gacgaaatagaagaaatcaaggaaaccctcatagattggtgtgatgaaaaggaactgaat
ttgatattaacaactggaggaacaggatttgcaccacgagatgtcactccagaggccaca
aaagaagtaatagaacgggaagcaccagggatggccctggcaatgctgatgggatcactt
aatgttacacctctgggcatgctctctaggcctgtatgtggaatcagagggaaaacgctc
ataattaacctgccaggtagcaagaaaggatctcaggaatgctttcagttcatactgcca
gctctacctcatgccattgaccttctacgtgatgccattgtaaaagtaaaggaggtgcat
gatgaacttgaagatttgccttccccgccacctcctctttcccctcctcctacaaccagt
ccccataaacagacagaagataaaggggttcaatgtgaggaagaggaagaagagaagaaa
gacagtggtgttgcttcaacagaagatagttcctcatcacatataactgcagcagccatt
gctgccaagaagcatccattctacaccagtcccgctgttgtcatggcacatggtgagcag
cccatccctggtctcatcaattattcccatcattcagcagatgaacggattccagactcc
atcatttctcgtggtgttcaggtgctcccacgagacacagcctccctcagcactactcct
tcagaatcgcctcgtgctcaggctacatctcgcctctctacagcttcctgcccaacacca
aaagtccagtccaggtgcagcagcaaggagaatattcttagagccagtcacagtgctgtc
gatatcaccaaggtggctagaagacatcgcatgtctccttttcctctgacatctatggac
aaagcctttatcacagtcctggagatgactccggtgcttggaacagaaatcatcaattac
cgagatggaatggggcgagtccttgctcaagatgtatatgcaaaagacaatttacccccc
ttcccagcatcagtaaaagatggctatgctgtccgagctgctgatggcccaggagatcgt
ttcatcattggggaatcccaagctggtgaacagccaactcagacagtaatgccaggacaa
gtcatgcgggttactacaggtgctccaataccctgcggtgctgatgcagtagtacaagtg
gaagatactgaacttatcagggaatcagacgacggcactgaagaacttgaagtgcgaatt
ctggtgcaagctcggccaggccaagatatcagacccatcggccatgacattaaaagaggg
gaatgtgttttggccaaaggaacccacatgggcccctcagagattggtcttctagcaact
gtaggtgtcacagaggttgaagttaacaagtttccagtggttgcagtcatgtcaacaggg
aatgagctgctaaatcctgaagatgacctcttaccagggaagattcgagacagcaatcgt
tcaactcttctagcaacaattcaggaacatggttaccccacaatcaacttaggtattgta
ggagacaacccagatgacttactcaatgccttgaatgagggtatcagtcgtgctgatgtc
atcatcacatcagggggtgtatccatgggggaaaaggactatctcaagcaggtgctggac
attgatcttcatgctcagatccattttggcagggtttttatgaaaccaggcttgccaaca
acctttgcaactttggatattgatggtgtaagaaaaataatctttgcactacctgggaat
cctgtatcagctgtggtcacctgcaatctctttgttgtgcctgcactgagaaagatgcag
ggcatcttggatcctcggccaaccatcatcaaagcaaggttatcatgtgatgtaaaactg
gatcctcgtccagaataccatcggtgtatactaacttggcatcaccaagaaccactgcct
tgggcacagagtacaggtaatcaaatgagcagccgtttgatgagcatgcgcagtgccaat
ggattgttgatgctacctccaaagacagaacagtacgtggagctccacaaaggcgaggtg
gtggatgtcatggtcattggacggctatga

DBGET integrated database retrieval system