KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396248Help
Entry
100396248         CDS       T03264                                 

Gene name
IL9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04630  Jak-STAT signaling pathway
cjc05310  Asthma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100396248 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100396248 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100396248 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100396248 (IL9)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100396248 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 100396248
NCBI-ProteinID: XP_002744224
Ensembl: ENSCJAG00000005916
UniProt: F7HMS2
Position
2
AA seq 144 aa AA seqDB search
MLLAMVLTSALLLCSVAGHGCPTLVGIRDINYLIDKMKEDPSSKCNCRANVTSCLCLPIP
SDNCTRPCFKEGLSQMTNTTVQTRYSLIFSRVKKSVEVLENKKCPYFSCEQPCNQTVAGN
VLTFLKSLLEVFQKEKMRGMGGKI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggccatggtccttacttctgcgcttctgctgtgctccgtggccggccacggg
tgtccaacattagtgggcatcagggacatcaactacctgattgacaagatgaaggaagat
ccatcttcgaagtgcaactgcagagctaatgtgaccagttgtctctgtctgcccattcct
tctgacaactgcaccagaccatgcttcaaggaggggctgtctcagatgaccaataccaca
gtgcaaacgagatactcgctgattttcagtcgggtgaaaaaatccgttgaagtactagag
aacaagaagtgtccatatttctcctgtgaacagccatgcaaccaaaccgtggcaggcaat
gtgctgacatttctgaagagcctcctagaagttttccagaaagaaaagatgagaggaatg
ggaggcaaaatatga

DBGET integrated database retrieval system