KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396363
Entry
100396363         CDS       T03264                                 
Symbol
RARB
Name
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05200  Pathways in cancer
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100396363 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100396363 (RARB)
   05222 Small cell lung cancer
    100396363 (RARB)
   05223 Non-small cell lung cancer
    100396363 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100396363 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cjc03310]
    100396363 (RARB)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100396363 (RARB)
Nuclear receptors [BR:cjc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100396363 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100396363
NCBI-ProteinID: XP_002759706
Ensembl: ENSCJAG00000003911
Position
17:55808451..56357040
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECRESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSAEHRVPTGPGPRDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLMKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacacc
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcgattgaaacacagagcaccagc
tctgaggaactcgtcccaagccctccatctccacttcctccccctcgagtgtacaaaccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagacttcgaagcaagaatgcagagagagctatgaaatgacagctgagctggacgatctc
acagagaagattcgaaaagctcaccaagaaactttcccttcgctctgccagctgggtaaa
tacactacgaattccagtgctgagcatcgagttccgacgggacctgggcctcgggacaaa
ttcagtgaactggccaccaagtgcattatcaagatcgtggagtttgctaaacgcctcccg
ggcttcaccagcttgaccatcgcagaccagatcaccttgatgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttttca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccaacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgcagcatc
agtgctaaaggtgcggaacgtgtaattaccttgaaaatggaaattcctggatcaatgccg
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagcggg
gtcagtcagtcaccactggtgcaataa

DBGET integrated database retrieval system