KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396597Help
Entry
100396597         CDS       T03264                                 

Gene name
ACTA2
Definition
(RefSeq) actin, alpha 2, smooth muscle, aorta
  KO
K12313  actin, aortic smooth muscle
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100396597 (ACTA2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100396597 (ACTA2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100396597 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100396597 (ACTA2)
   04147 Exosome [BR:cjc04147]
    100396597 (ACTA2)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100396597 (ACTA2)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100396597 (ACTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 100396597
NCBI-ProteinID: XP_002756423
Ensembl: ENSCJAG00000005576
UniProt: F7IH64
Position
12
AA seq 377 aa AA seqDB search
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaagaggacagcactgccttggtgtgtgacaatggctctggactctgtaag
gctggctttgctggggatgatgctcccagggctgttttcccatccatcgtgggacgtccc
agacatcagggggtgatggtgggaatgggacaaaaagacagctacgtgggtgatgaagca
cagagcaaaagaggaatcctgaccctgaagtacccgatagaacatggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactctttctacaatgaacttcgtgttgctcct
gaagagcacccaactctgctcacagaggcacccctgaaccccaaggccaaccgggagaaa
atgacccagattatgtttgagactttcaatgtcccagccatgtacgtggctatccaggcg
gtgctgtccctctacgcctctggacgcacaactggcatcgtgctggactccggagatggt
gtcacccacaatgtccccatctatgagggctatgccttgccccatgccatcatgcgtctg
gatctggctggccgagatctcactgactacctcatgaagatcctgactgagcgtggatat
tccttcgttactaccgctgagcgtgagattgttcgggacatcaaggagaaactgtgttac
gtagctctggactttgaaaatgagatggccactgccgcatcctcctcctcccttgagaag
agttatgagctgcctgatgggcaagtgatcaccatcggaaatgaacgcttccgctgccca
gagaccctgttccagccatccttcatcgggatggagtctgcaggcattcatgaaaccacc
tacaacagcatcatgaagtgtgatattgatatcaggaaggacctctacgctaacaatgtc
ctatcgggaggcaccactatgtaccctggcattgccgaccgaatgcagaaggagatcaca
gccctagcgcccagcaccatgaagatcaagatcattgcccctccggagcgcaaatattct
gtctggatcggtggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggaatatgatgaagccgggccttccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system