KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396611Help
Entry
100396611         CDS       T03264                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100396611 (MAPK11)
   04010 MAPK signaling pathway
    100396611 (MAPK11)
   04370 VEGF signaling pathway
    100396611 (MAPK11)
   04668 TNF signaling pathway
    100396611 (MAPK11)
   04068 FoxO signaling pathway
    100396611 (MAPK11)
   04071 Sphingolipid signaling pathway
    100396611 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100396611 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100396611 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100396611 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100396611 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100396611 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100396611 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    100396611 (MAPK11)
   04660 T cell receptor signaling pathway
    100396611 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    100396611 (MAPK11)
   04659 Th17 cell differentiation
    100396611 (MAPK11)
   04657 IL-17 signaling pathway
    100396611 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100396611 (MAPK11)
   04670 Leukocyte transendothelial migration
    100396611 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100396611 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100396611 (MAPK11)
   04917 Prolactin signaling pathway
    100396611 (MAPK11)
   04926 Relaxin signaling pathway
    100396611 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100396611 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    100396611 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100396611 (MAPK11)
   04722 Neurotrophin signaling pathway
    100396611 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100396611 (MAPK11)
  09158 Development
   04380 Osteoclast differentiation
    100396611 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    100396611 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100396611 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100396611 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100396611 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100396611 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100396611 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100396611 (MAPK11)
   05133 Pertussis
    100396611 (MAPK11)
   05152 Tuberculosis
    100396611 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100396611 (MAPK11)
   05161 Hepatitis B
    100396611 (MAPK11)
   05163 Human cytomegalovirus infection
    100396611 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100396611 (MAPK11)
   05169 Epstein-Barr virus infection
    100396611 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100396611 (MAPK11)
   05140 Leishmaniasis
    100396611 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    100396611 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100396611 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100396611 (MAPK11)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100396611 (MAPK11)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100396611 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100396611
NCBI-ProteinID: XP_002743919
Position
1
AA seq 461 aa AA seqDB search
MRAGGRCPPLVPPPREREGRFPLCHRLRGAGSSAFVSGNPPPQATQPGKSARASRPRPGA
PPPRPPPPPRPSAQLSSGSGSGSGAGQDTGGAAAAPDMSRPRAGFYRQELNKTVWEVPQR
LQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENV
IGLLDVFTPATSIEDFTEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHS
AGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQT
VDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLP
PMPQKDLSSIFHGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPY
DESVEAKERTVEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgggagggaggtgtccgcccttggtgccccccccccgggaaagggagggccgg
tttccgctctgccaccgcctccgaggcgcaggaagcagcgcatttgtctccgggaacccc
ccgccccaggctacccagcccgggaaatccgcccgggcctcccggccccgccccggagcc
ccgcccccgcgcccgccaccgcctccgcggccctccgctcagctcagctcgggctcgggc
tcgggctcgggcgcggggcaggacacgggcggagcggcagccgctccggacatgtcgcgc
cctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtgccgcagcgg
ctgcagggtctgcgcccggtgggctccggcgcctacggctccgtctgttcggcctacgac
gcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccagtcgctgatc
cacgcgcgcaggacgtaccgggagctgcggctgctcaagcacctgaagcacgagaacgtc
attgggcttctggatgtcttcacgccggccacgtccatcgaggacttcaccgaagtgtac
ttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccaggcgctgagc
gacgagcacgttcagttcctggtttaccagctgctgcgcgggctgaagtacatccactcg
gccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgaggactgtgag
ctcaggatcctggacttcgggttggcccgccaggcagacgaagagatgacgggctacgtg
gccacgcgctggtaccgggcccctgaaatcatgctcaactggatgcattacaaccagaca
gtggacatctggtctgtgggctgcatcatggctgagctactccagggcaaggccctcttc
ccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggcacacccagc
ccggaggttctggcaaagatctcctcggaacacgcccggacatacatccagtccttaccc
cccatgccccagaaggacctgagcagcatcttccacggagccaaccccctggccatagac
ctcctaggaaggatgctggtgctggatagtgaccagagggtcagtgcggcagaggcgctg
gcccacgcctacttcagccagtaccatgaccctgaggatgagccagaggccgagccgtac
gacgagagtgttgaggccaaggagcgcaccgtggaggagtggaaggagctcacctaccag
gaagtcctcagcttcaagcccccagagccaccgaagccgcctggcagcctggagattgag
cagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396967Help
Entry
100396967         CDS       T03264                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100396967 (MAPK12)
   04010 MAPK signaling pathway
    100396967 (MAPK12)
   04370 VEGF signaling pathway
    100396967 (MAPK12)
   04668 TNF signaling pathway
    100396967 (MAPK12)
   04068 FoxO signaling pathway
    100396967 (MAPK12)
   04071 Sphingolipid signaling pathway
    100396967 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100396967 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100396967 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100396967 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100396967 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100396967 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100396967 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100396967 (MAPK12)
   04660 T cell receptor signaling pathway
    100396967 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100396967 (MAPK12)
   04659 Th17 cell differentiation
    100396967 (MAPK12)
   04657 IL-17 signaling pathway
    100396967 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100396967 (MAPK12)
   04670 Leukocyte transendothelial migration
    100396967 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100396967 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100396967 (MAPK12)
   04917 Prolactin signaling pathway
    100396967 (MAPK12)
   04926 Relaxin signaling pathway
    100396967 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100396967 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100396967 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100396967 (MAPK12)
   04722 Neurotrophin signaling pathway
    100396967 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100396967 (MAPK12)
  09158 Development
   04380 Osteoclast differentiation
    100396967 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100396967 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100396967 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100396967 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100396967 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100396967 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100396967 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100396967 (MAPK12)
   05133 Pertussis
    100396967 (MAPK12)
   05152 Tuberculosis
    100396967 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100396967 (MAPK12)
   05161 Hepatitis B
    100396967 (MAPK12)
   05163 Human cytomegalovirus infection
    100396967 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100396967 (MAPK12)
   05169 Epstein-Barr virus infection
    100396967 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100396967 (MAPK12)
   05140 Leishmaniasis
    100396967 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    100396967 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100396967 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100396967 (MAPK12)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100396967 (MAPK12)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100396967 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100396967
NCBI-ProteinID: XP_002806616
Ensembl: ENSCJAG00000003322
Position
1
AA seq 368 aa AA seqDB search
MSSPPPARSGFYRQEVTKTAWEVRVVYRDLQPVGSGAYGAVCSAVDSRTSAKVAIKKLYR
PFQSELFAKRAYRELRXLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLKYIHAAGIIHRVRLKPGNLAVNEDCELKILDFGLARQAD
SEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMISGKTLFKGSDHLDQLKEIM
KVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQR
VTAAEALAHPYFESLHDTEDEPQAQKYDESFDDVDRTLDEWKRVTYKEVLSFKPPRQLGA
RVSKETAL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgtcgtgtaccgggacctgcagcccgtgggctcgggcgcctatggcgcg
gtgtgctccgcggtggacagccgcaccagcgccaaggtggccatcaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgggagctgcgcntgctcaagcac
atgcgccacgagaacgtgattgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttatctggtgatgccattcatgggcactgacctggggaagctcatg
aagcacgagaagctgggagaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaagtatatccacgctgccggcatcatccacagagtgagactgaagcctggcaacctg
gctgtgaatgaagactgtgagctgaagatcctggactttggcctggccaggcaggccgac
agcgagatgactgggtatgtggtgactcggtggtaccgggcacctgaggtcatcttgaat
tggatgcgatacacacagacggtggacatctggtctgtgggctgcatcatggcagagatg
atctcaggcaagacactgtttaaaggcagcgaccacctggaccagctgaaagagatcatg
aaggtgacaggaacgcctccagctgagtttgtgcagcggctgcaaagcgatgaggccaag
aactacatgaagggcctccctgagttggagaagaaggattttgcctccatcctgaccaac
gcaagccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgg
gtgacggcagctgaggcgctggctcacccctactttgagtccctgcacgacacggaagac
gagccccaggcccagaagtatgatgagtcctttgacgatgtggaccgcacactggatgaa
tggaagcgtgtcacttacaaagaggtgctcagcttcaagcctccccggcagctgggggcc
agggtctccaaggagacggctctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404377Help
Entry
100404377         CDS       T03264                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100404377 (MAPK14)
   04010 MAPK signaling pathway
    100404377 (MAPK14)
   04370 VEGF signaling pathway
    100404377 (MAPK14)
   04668 TNF signaling pathway
    100404377 (MAPK14)
   04068 FoxO signaling pathway
    100404377 (MAPK14)
   04071 Sphingolipid signaling pathway
    100404377 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100404377 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100404377 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100404377 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100404377 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100404377 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100404377 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100404377 (MAPK14)
   04660 T cell receptor signaling pathway
    100404377 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100404377 (MAPK14)
   04659 Th17 cell differentiation
    100404377 (MAPK14)
   04657 IL-17 signaling pathway
    100404377 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100404377 (MAPK14)
   04670 Leukocyte transendothelial migration
    100404377 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100404377 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100404377 (MAPK14)
   04917 Prolactin signaling pathway
    100404377 (MAPK14)
   04926 Relaxin signaling pathway
    100404377 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100404377 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100404377 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100404377 (MAPK14)
   04722 Neurotrophin signaling pathway
    100404377 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100404377 (MAPK14)
  09158 Development
   04380 Osteoclast differentiation
    100404377 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100404377 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100404377 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100404377 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100404377 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100404377 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100404377 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100404377 (MAPK14)
   05133 Pertussis
    100404377 (MAPK14)
   05152 Tuberculosis
    100404377 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100404377 (MAPK14)
   05161 Hepatitis B
    100404377 (MAPK14)
   05163 Human cytomegalovirus infection
    100404377 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100404377 (MAPK14)
   05169 Epstein-Barr virus infection
    100404377 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100404377 (MAPK14)
   05140 Leishmaniasis
    100404377 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    100404377 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100404377 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100404377 (MAPK14)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100404377 (MAPK14)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100404377 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 100404377
NCBI-ProteinID: XP_008992578
Ensembl: ENSCJAG00000015852
Position
4
AA seq 360 aa AA seqDB search
MSQERPTFYSQELNKTILEVPERYXNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagagacccacgttctattcgcaggagctgaacaagacaatcttggaggtg
cccgagcgttacnaaaacctgtctccggtgggctccggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacgggattacgtgtggcagtgaagaagctatccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gacgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccacgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtatagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcc
caagcccttgcacatgcctactttgctcagtaccatgatcctgatgatgaaccagtggcc
gatccttacgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagtctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405093Help
Entry
100405093         CDS       T03264                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04015  Rap1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04218  Cellular senescence
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04370  VEGF signaling pathway
cjc04380  Osteoclast differentiation
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04611  Platelet activation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04657  IL-17 signaling pathway
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04714  Thermogenesis
cjc04722  Neurotrophin signaling pathway
cjc04723  Retrograde endocannabinoid signaling
cjc04728  Dopaminergic synapse
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cjc05418  Fluid shear stress and atherosclerosis
Module
cjc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100405093 (MAPK13)
   04010 MAPK signaling pathway
    100405093 (MAPK13)
   04370 VEGF signaling pathway
    100405093 (MAPK13)
   04668 TNF signaling pathway
    100405093 (MAPK13)
   04068 FoxO signaling pathway
    100405093 (MAPK13)
   04071 Sphingolipid signaling pathway
    100405093 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100405093 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100405093 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100405093 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100405093 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100405093 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100405093 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100405093 (MAPK13)
   04660 T cell receptor signaling pathway
    100405093 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100405093 (MAPK13)
   04659 Th17 cell differentiation
    100405093 (MAPK13)
   04657 IL-17 signaling pathway
    100405093 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100405093 (MAPK13)
   04670 Leukocyte transendothelial migration
    100405093 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100405093 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100405093 (MAPK13)
   04917 Prolactin signaling pathway
    100405093 (MAPK13)
   04926 Relaxin signaling pathway
    100405093 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100405093 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100405093 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100405093 (MAPK13)
   04722 Neurotrophin signaling pathway
    100405093 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100405093 (MAPK13)
  09158 Development
   04380 Osteoclast differentiation
    100405093 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100405093 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100405093 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100405093 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100405093 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100405093 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100405093 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100405093 (MAPK13)
   05133 Pertussis
    100405093 (MAPK13)
   05152 Tuberculosis
    100405093 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100405093 (MAPK13)
   05161 Hepatitis B
    100405093 (MAPK13)
   05163 Human cytomegalovirus infection
    100405093 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100405093 (MAPK13)
   05169 Epstein-Barr virus infection
    100405093 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100405093 (MAPK13)
   05140 Leishmaniasis
    100405093 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    100405093 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100405093 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100405093 (MAPK13)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100405093 (MAPK13)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100405093 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100405093
NCBI-ProteinID: XP_002746519
Ensembl: ENSCJAG00000015899
UniProt: U3BML8
Position
4
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTVWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELQLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQSDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARPADVEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLSQILKVTG
VPGTEFVQKLKDKAAKSYIQALPQSPKKDFTQLFPQASPQAVDLLEKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQHPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcaggaaaaaaggcttctacaagcaggacgtcaacaagaccgtctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatcttcgccaagcgcgcctaccgggagctgcagctgctgaagcacatgcag
catgagaacgtaattgggctcctggatgtcttcaccccagcgtcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagtcggatctgcagaagatcatggggatg
gagttcagtgaggataagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactcagctggggtcgtgcacagggacctgaagccgggcaacctggctgtgaacgag
gattgtgaactgaagatcctggattttgggctggcacggcctgcagatgtcgagatgact
ggctacgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtcggctgtatcatggcggagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgagccagatcctgaaagtgaccggg
gtaccaggcacagagtttgtgcagaagctgaaagacaaagcggccaaatcctacatccag
gccctgccacagagccccaagaaggatttcactcagctcttcccacaggccagcccccag
gccgtggacctgctggagaagatgctggagctggacgtggacaagcgcctgacagccgcg
caggcccttgcccatcccttctttgaacccttccgggaccctgaggaagaaacggaggcc
cagcatccatttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system