KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396804Help
Entry
100396804         CDS       T03264                                 

Gene name
IL18
Definition
(RefSeq) interleukin 18
  KO
K05482  interleukin 18
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc05132  Salmonella infection
cjc05134  Legionellosis
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05152  Tuberculosis
cjc05164  Influenza A
cjc05321  Inflammatory bowel disease (IBD)
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100396804 (IL18)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100396804 (IL18)
   04623 Cytosolic DNA-sensing pathway
    100396804 (IL18)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100396804 (IL18)
   05321 Inflammatory bowel disease (IBD)
    100396804 (IL18)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100396804 (IL18)
   05134 Legionellosis
    100396804 (IL18)
   05152 Tuberculosis
    100396804 (IL18)
  09172 Infectious disease: viral
   05164 Influenza A
    100396804 (IL18)
  09174 Infectious disease: parasitic
   05144 Malaria
    100396804 (IL18)
   05143 African trypanosomiasis
    100396804 (IL18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100396804 (IL18)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100396804 (IL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 100396804
NCBI-ProteinID: XP_002754458
Ensembl: ENSCJAG00000012499
UniProt: U3CWC9
Position
11
AA seq 193 aa AA seqDB search
MAAEPVEDNCINFVEMKFTGDALYFRAEDDENLETDHFAKLKSKLAIIRNVDDQVLFLGQ
GNHPLFEDMTDSDCEANASRTIFIIYMYKDSEPRGLAVTISVKCGKISTLSCENKIISFK
EISPPDNITDTKSDIIFFQRSVPGHDDKMQFESSSYEGYFLACKKEEDLFKLILKRKDEL
GDKSLLFTVQSKD
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaaccagtagaagacaattgcatcaactttgtggaaatgaaatttactggc
gatgcactttactttagagctgaagatgatgaaaacctggaaacagatcactttgccaag
cttaaatccaaattagcaattataagaaatgtggatgaccaagttctcttccttggccaa
ggaaatcaccctctgtttgaggatatgactgattctgactgtgaagcaaatgcatcccgg
accatatttattatatatatgtataaagatagcgagcctagaggtctggctgtaaccatc
tctgtgaagtgtggaaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatcagccctcccgacaacatcactgatacaaaaagtgacatcattttttttcagaga
agtgttccagggcatgatgataagatgcagtttgagtcttcatcatacgaaggctacttt
ttagcctgtaaaaaagaggaagatcttttcaaactcattttgaaaagaaaggatgaattg
ggggataaatccttattgttcacggttcaaagcaaagactag

DBGET integrated database retrieval system