KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396838Help
Entry
100396838         CDS       T03264                                 

Gene name
GRK3
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04062  Chemokine signaling pathway
cjc04144  Endocytosis
cjc04340  Hedgehog signaling pathway
cjc04724  Glutamatergic synapse
cjc04740  Olfactory transduction
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100396838 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100396838 (GRK3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100396838 (GRK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100396838 (GRK3)
  09157 Sensory system
   04740 Olfactory transduction
    100396838 (GRK3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100396838 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100396838 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100396838 (GRK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     100396838 (GRK3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100396838 (GRK3)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100396838 (GRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS PH HTH_WhiA Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 100396838
NCBI-ProteinID: XP_017834078
Ensembl: ENSCJAG00000009283
UniProt: U3FQ72
Position
1
AA seq 688 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEYGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDAFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGIDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADADKTEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSSTVELSKPSLCHRNSNGL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgatgtcagttacctgatggccatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgcccgagcccagtatccgg
agtgtgatgcagaagtatctcgcagagagaaacgaaataacctttgacaagattttcaat
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagatcaaagaatatgaaaagcttgataatgaggaagac
cgcctttgcagaagtcgacaaatttatgacgcctacatcatgaaggagcttctctcctgc
tcacatcctttctcaaagcaagctgtagaacacgtgcaaagtcacttatccaagaagcaa
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagccttcgaggtgac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaacgtt
gaattgaatatccatttgaccatgaatgagttcagcgtgcataggattattggacgagga
ggattcggggaagtttatggttgcaggaaagcagacactggaaaaatgtatgcgatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggggaaacattagccttaaatgaaaga
atcatgttgtctcttgtcagcacaggagactgtcctttcattgtatgtatgacctatgcc
ttccataccccagataaactctgcttcatcctggatctgatgaacgggggcgatttgcac
taccacctttcacagcacggggtgttctctgagaaggagatgcggttttatgccacggag
atcattctgggtctggaacacatgcacaatcgatttgttgtttacagagacttgaagcca
gcaaatatcctcttggatgaatatggacacgcgaggatatcagatcttggtcttgcttgc
gatttttccaaaaagaagcctcatgctagcgttggcacccatgggtacatggctccggag
gtgctgcagaaggggacggcctacgacagcagtgccgactggttctccctgggctgcatg
cttttcaaacttctgagaggtcacagccctttcagacagcataaaaccaaagacaagcat
gagattgaccgaatgaccctcaccgtgaatgtggaacttccagatgccttctctcctgaa
ctgaagtcccttttggagggcttgctccagcgagacgttagcaagcggctgggctgtcac
ggaggcggctcacaggaagtaaaagagcacagctttttcaaaggtattgactggcagcat
gtctacttacaaaagtaccccccacccttgattcctccccggggagaagtcaatgctgct
gatgcctttgatattggctcatttgatgaagaagataccaaaggcattaagctgcttgat
tgcgaccaagaactctacaagaacttccctctggtcatctctgaacgctggcagcaggag
gtcacggaaaccgtttacgaagcagtcaatgcagacgcggataaaactgaggccagaaag
agagctaaaaataagcagcttggccacgaagaagattacgctctggggaaggactgcatt
atgcacgggtacatgctgaaactgggaaacccatttctgactcagtggcagcgtcgctat
ttttacctctttccaaatagacttgaatggagaggagagggagagtcccggcaaaattta
ctgacaatggaacagattctctctgtggaagaaactcaaattaaagacaaaaaatgcatt
ttgttcagaataaaaggagggaagcaatttgtcttgcaatgtgagagtgatccagagttc
gtgcagtggaagaaggagttaaacgaaaccttcaaggaggcccagcgactgctgcgtcgc
gccccgaagttcctcaacaaacctcggtccagcactgtggagctctcaaagccatccctc
tgtcacagaaacagcaatggcctctag

DBGET integrated database retrieval system