KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397021Help
Entry
100397021         CDS       T03264                                 

Gene name
BLM
Definition
(RefSeq) Bloom syndrome RecQ like helicase
  KO
K10901  bloom syndrome protein [EC:3.6.4.12]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00295  BRCA1-associated genome surveillance complex (BASC)
cjc_M00414  Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100397021 (BLM)
   03460 Fanconi anemia pathway
    100397021 (BLM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100397021 (BLM)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100397021 (BLM)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100397021 (BLM)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100397021 (BLM)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     100397021 (BLM)
    Bloom's syndrome complex (BTR)
     100397021 (BLM)
   FA (Fanconi anemia) pathway
     100397021 (BLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BLM_N BDHCT_assoc DEAD BDHCT RecQ_Zn_bind RQC Helicase_C HRDC ResIII
Motif
Other DBs
NCBI-GeneID: 100397021
NCBI-ProteinID: XP_002749167
Ensembl: ENSCJAG00000009803
Position
6
AA seq 1415 aa AA seqDB search
MAAVPQNNLQEQLERHSARKLNNKLSLSKPKFSGFTFKKKTSSDNNVSLTNVSVAKTPVL
RNKDVNVAEHFSFSEPLPPTTDQQRGKDFSKNVPAGQQTQRVGSKPLLPDFLQTPKEVLC
TTQNTPTLEKSRDTAFKKLEFSSSPDSLSTINDWDDMDDFDTSGTSKAFVTPPQSHFVRV
STAQKSKKAKRNFFKAQLCATNTVKADLPPSSESKQIDLTVEQKDDSEWFSSDVICIDDG
PIAEVHVNEDAQESDSLKTHLQDERDNNEKKKNVEEAELHSTEKVPCIEFDDDDYDIDFV
PPSPEEIISASSSSSKCFSVSKDLDTSDRREDVLGTSKDLLSKPEKMTMQEPNPETSTDC
DARRISLQQQLIHVMDRICKLVDIIPADKLKLLDCGNELLQQRNIRRKLLTEVDLNKSDA
SLLGPVWRCRPDSLDEPVEGDSCPTENSMKGLNFLHLSSDSVSPGECLLTTTPGKTGFSA
TRENLFERPLFNTHLQKSFVSSNWAETPRLEKRNESPYFPGNVLTSTAVKDWNKHTASIN
DLERESQPSCDIGNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSEQLS
SAKTNCLPVASTAQNKNFSESMQNYTDKSTQNLASRNLKHERFQGLSFPHTKEMMKIFHK
KFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTIVISPLRSLIV
DQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLE
NLYERRLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDI
LTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHYPYDSGIIYCLSRREC
DTMADTLQRDGLSALAYHAGLSDSARDEIQQKWINQDGCQVICATIAFGMGIDKPDVRFV
IHASLPKSMEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFN
NLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHADVSCDNCCKTKDYKTRDVTDDV
KSIIRFVQEHSSSQGARNIKHIGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHN
AERLFKKLILDKILDEDLYINANDQAIAYMMLGNKAQGVLNGNLKVDFMETENSSSVKKQ
KALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLL
QIDGVTEDKLEKYGAEVIAVLQKYSEWTLPAEDSSPGISLSGSRGPGKSATEKLDEEIPV
SSHYFANNTGNERKRKRMPASQRSKRRKTASGGSKAKGGSATRRKMSSRTKSSIAGSSSA
SHASQATSGANRKLGIMAPPKPINRPFLKPSYAFA
NT seq 4248 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttcctcaaaataatctacaggagcagctggaacgtcactcagccagaaag
cttaataataaattaagtctttcaaaaccaaaattttccggtttcacttttaaaaagaaa
acatcttcagataacaatgtatctctaactaatgtgtctgtagcaaaaacacctgtatta
agaaataaagatgttaatgtcgcggaacacttttccttcagtgaacctctgccccccacc
acagatcagcaaaggggcaaggacttctctaaaaatgttccagcaggacagcaaacacag
agggttggatcaaaaccattattgccagatttcttgcagactccgaaggaagttttatgc
actacccaaaacacaccaaccctagagaaatcccgggatactgctttcaagaaattagaa
tttagttcttcaccagattctttaagtaccatcaatgattgggatgatatggatgacttt
gatacttctgggacttcaaaagcatttgttacaccaccccagagtcactttgtcagagta
agcaccgctcagaaatcaaaaaaggctaagagaaacttttttaaagcccagctttgtgca
acaaacacagtaaaggctgatttgcctccatcctctgaaagcaagcaaatagatttgact
gtggagcagaaggatgactcagaatggttcagcagcgatgtgatttgcatcgatgatggc
cccattgccgaagtgcatgtaaatgaagatgctcaggaaagtgactctttgaaaactcat
ttgcaagatgaaagagataataatgaaaagaagaagaatgtggaagaagctgaattacat
tctactgagaaagttccatgtattgaatttgatgatgatgattatgatatagattttgtt
ccaccttctccagaagaaattatttctgcttcttcttcctcttcaaaatgctttagtgtg
tcaaaggaccttgacacctctgacagaagagaggatgttcttggcacatcaaaagatctt
ttgtcaaaacctgagaaaatgaccatgcaggagcctaatccagaaaccagcacagactgt
gacgctagacggataagtttacagcaacaacttattcacgtgatggatcgcatctgtaaa
ttagttgatattattcctgctgataaactgaaacttttggattgtggaaacgaactgctt
cagcagcggaacataagaaggaaacttctaacagaagtagatttaaataaaagtgatgcc
agtcttcttggcccagtttggagatgcagacctgattcacttgatgagcccgtggagggt
gattcctgccctacagagaattctatgaaggggttaaattttctacacctttcctcagat
tctgtttctcctggggaatgtttactgactaccaccccaggaaagacaggattctcagcc
accagggagaatctttttgaaaggcctttattcaatacccatttacagaagtcctttgta
agtagcaactgggctgaaacaccaagactagaaaaaagaaatgaaagcccttatttccca
ggaaatgttctcacaagcactgctgtgaaagattggaataaacatactgcttcaataaat
gacttggaaagagaaagccagccttcctgtgacattggtaattttgacatagatgacttt
gatgatgatgatgactgggaagatataatgcataatttagcagccagcaaatcttccaca
gctgcctatcaacccatcaaggaaggtcggccaattaaatcagtatcagaacaactttct
tcagccaagacaaactgtcttccagtggcgtctactgcgcaaaataaaaacttctcagag
tcaatgcagaattacactgacaagtcaacacaaaatttagcatccagaaatctgaaacat
gagcgtttccaaggtcttagttttcctcatacaaaggaaatgatgaagatttttcataaa
aaatttggcctgcataattttagaactaatcagctagaggcgatcaatgctgctctgctt
ggtgaagactgttttatcctgatgccgactggaggtggtaagagtttgtgttaccagctc
cccgcctgtgtttctcctggggtcacgattgtcatttctcccttgagatcactaatagta
gatcaagtccaaaagctgacttccttggatattccagctacatatctgacaggtgataag
actgactcagaagctacaaatatttacctccagttatcaaaaaaagacccaatcataaaa
cttctatatgtcactccggagaagatctgtgcaagtaacagactcatctctactctggag
aatctctatgagaggaggctcttggcacgttttgttattgatgaagcacattgtgtcagt
cagtggggacatgattttcgtcaagattacaaaagaatgaatatgcttcgtcagaagttt
ccttctgttccggtgatggctcttacggccacagctaatcccagggtacagaaggacatc
ctcactcagctgaagattctcagacctcaggtgtttagcatgagctttaacagacataat
ctgaaatactacgtgttaccaaaaaagcccaaaaaggtggcatttgattgcctagaatgg
atcagaaagcactacccatatgactcagggataatttactgcctctccaggcgagaatgc
gacaccatggctgacacattacaaagagatgggctctctgctcttgcttaccatgctggc
ctcagtgattctgccagagatgaaatacagcagaagtggattaatcaggatggctgtcag
gttatctgtgcaacaattgcatttggaatggggattgacaaaccggacgtgcgatttgtg
attcatgcatctctccctaaatctatggagggttactaccaagaatctggcagagctgga
agagatggggaaatatctcactgcttgcttttctatacctatcatgacgtgaccagactg
aaaagacttataatgatggaaaaagatggaaaccatcatacaagagaaactcacttcaat
aatttgtatagcatggtacattactgtgaaaatataacagaatgcaggagaatacagctt
ttggcttactttggtgaaaatggatttaatcctgatttttgtaagaaacacgcagatgtt
tcttgtgataattgctgtaaaacaaaggattataaaacaagagacgtgactgatgatgtg
aaaagcattataagatttgttcaagaacatagttcatcacaaggagcaagaaatataaaa
catataggtccttctggaagatttactatgaatatgctggtcgacattttcttggggagt
aagagtgcaaaaatccagtcaggtatatttgggaaaggatctgcttattcacgacacaat
gccgaaagactttttaaaaagctgatacttgacaagattttggatgaagatttatatatc
aatgccaatgaccaagcgatcgcttatatgatgctcggaaataaagcccaaggtgtacta
aatggcaatttaaaggtagactttatggaaacagaaaattccagcagtgtgaaaaaacaa
aaagcattagtagcaaaagtatctcagagggaagagatggtgaagaaatgtcttggagaa
ctcacagaagtctgcaaatctctggggaaggtttttggtgtccattacttcaatattttt
aataccgtcactctaaagaagcttgcagaatctttatcttctgatcctgaggttttgctt
caaattgatggtgttactgaagacaaactggaaaaatatggtgcggaagtgattgcagtc
ttacagaaatactctgagtggacattgccagctgaggacagttccccagggataagcctg
tccggcagcagaggccccggaaaaagtgccactgagaagctggacgaggaaatacccgtt
tcttctcactactttgcaaataacactggaaatgaaaggaagaggaaaaggatgccagcc
tcccaaaggtctaagaggagaaaaaccgcttccggtggttccaaggcaaagggggggtct
gccacacggagaaagatgtcttccagaacaaaatccagcatcgctggatccagttcagcc
tcgcatgcttctcaagcaacatcaggagccaatagaaaattggggattatggctccacca
aagcctataaatagaccatttctgaagccttcgtatgcattcgcctaa

DBGET integrated database retrieval system