KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397110Help
Entry
100397110         CDS       T03264                                 

Gene name
LTA, TNLG1E
Definition
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04668  TNF signaling pathway
cjc04940  Type I diabetes mellitus
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100397110 (LTA)
   04668 TNF signaling pathway
    100397110 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397110 (LTA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100397110 (LTA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397110 (LTA)
   05168 Herpes simplex virus 1 infection
    100397110 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397110 (LTA)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100397110 (LTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100397110
NCBI-ProteinID: XP_008992392
Ensembl: ENSCJAG00000003124
UniProt: F7HRS5
Position
4
AA seq 205 aa AA seqDB search
MTPPERLFLSRVQGTPLHLLLLGLLLALLPGAQGLPGVGLTPSASQIARQHPKMHLARST
LKPAAHLVGDPSNQKSLRWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGNAY
SPKATPTPLYLAHEVQLFSSQYPFHVSLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIGHLVLSPSTVFFGAFAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacctgaacgtctcttcctctcaagggtgcagggcacccccctacacctcctc
cttctggggctgctgctggccctgcttcctggggcccaggggctccctggtgttggcctc
acaccttcagcctcccagattgcccgtcagcaccccaagatgcatcttgcccgcagcacc
ctcaaacctgctgctcacctcgttggagaccccagcaaccagaaatcactgcgctggaga
gcgaacacggaccgtgccttccttcaggatggtttctccttgagcaacaattctctcctg
gtccccaccagtggcatctactttgtctactcccaggtggtcttctctgggaacgcctac
tctcccaaggccacacccaccccgctctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccacgtgtctctcctcagctcccagaagatggtatatccagggctgcag
gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag
ctatccacccacacagatggcataggccacctagtcctcagccctagtactgtcttcttt
ggagcctttgctctgtag

DBGET integrated database retrieval system