KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397180Help
Entry
100397180         CDS       T03264                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04931  Insulin resistance
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05221  Acute myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100397180 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100397180 (RPS6KB2)
   04371 Apelin signaling pathway
    100397180 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100397180 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100397180 (RPS6KB2)
   04152 AMPK signaling pathway
    100397180 (RPS6KB2)
   04150 mTOR signaling pathway
    100397180 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100397180 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100397180 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100397180 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100397180 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100397180 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100397180 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397180 (RPS6KB2)
   05205 Proteoglycans in cancer
    100397180 (RPS6KB2)
   05231 Choline metabolism in cancer
    100397180 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100397180 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100397180 (RPS6KB2)
   05212 Pancreatic cancer
    100397180 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100397180 (RPS6KB2)
   05226 Gastric cancer
    100397180 (RPS6KB2)
   05221 Acute myeloid leukemia
    100397180 (RPS6KB2)
   05224 Breast cancer
    100397180 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100397180 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100397180 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100397180 (RPS6KB2)
   05165 Human papillomavirus infection
    100397180 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100397180 (RPS6KB2)
   01522 Endocrine resistance
    100397180 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100397180 (RPS6KB2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100397180 (RPS6KB2)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100397180 (RPS6KB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100397180
NCBI-ProteinID: XP_002755666
Ensembl: ENSCJAG00000000967
Position
11
AA seq 489 aa AA seqDB search
MAAVFDLDLETEEGSDCEGEPELSPADVCPLAELRAAGLEPVGHYEEVELTESSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTCGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSLGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQKHPFFRHMNWDDLLARCVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESADQAFLGFTYVAPSVLDSLKEGFSFQPKLRSPRRLNSSPRA
PISPLKFSPFEGFRPSPSLPEPMEPPLPPLLPPPPPPPPPPPPSITAPLPIRPHPGTKKS
KRGRGRPGH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtttgatctggatttggagaccgaggaaggcagcgactgcgagggagag
ccagagctcagccccgcggacgtgtgtccccttgccgagttgagggcagctggcctggag
cctgtggggcactatgaagaggtggagctgactgagagcagtgtgaacctcggcccggag
cgcatcgggccccactgttttgagctgctgcgtgtgctgggcaagggaggctatggcaag
gtgttccaggttcgaaaggtgcaaggcaccaacttgggcaaaatatacgccatgaaagtc
ctaaggaaggccaaaattgtgcgcaacgccaaggacacagcacacactcgggctgagcgg
aacattctggagtcagtgaagcacccctttattgtggaactggcctatgccttccagact
tgtggcaaactctacctcatcctcgagtgtctcagtggtggcgagctcttcacgcatctg
gagcgagagggcatcttcctggaagatacggcctgcttctacctggccgagatcacgctg
gccctgggccatctccactccctgggcatcatctaccgggacctcaaacccgagaacatc
atgctcagcagccagggccacatcaaactgaccgactttggactctgcaaggagtcgatc
catgagggcgctgtcactcacaccttctgcggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccaccctttactgcagagaaccggaagaaaaccatggataag
atcatcaagggcaagctggcgctgcccccctacctcacccctgatgcccgggaccttgtc
aaaaagtttctgaaacggaatcccagccagcggattgggggtggcccaggggatgctgct
gatgtgcagaagcacccctttttccggcacatgaattgggacgaccttctggcccgctgc
gtggacccccctttcaggccctgtctgcagtcagaggaggatgtgagccagtttgatacc
cgcttcacgcgacagacgccggtggacagtcccgatgacacggcccttagcgagagtgct
gaccaggccttcctgggcttcacgtatgtggcgccgtctgtcctggacagcctcaaggag
ggcttttccttccagcccaagctgcgctcacccaggcgcctcaacagcagccctcgggcc
cctatcagccccctcaagttctccccctttgaggggtttcggcctagccccagtctgcca
gagcccatggagccacctctacctccactcctgccaccgccgccgccgccaccaccacca
ccgccaccctcgatcaccgcccctctccccatccgtccccacccagggaccaagaagtcc
aagaggggccgtgggcgtccagggcactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409247Help
Entry
100409247         CDS       T03264                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04350  TGF-beta signaling pathway
cjc04371  Apelin signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04714  Thermogenesis
cjc04910  Insulin signaling pathway
cjc04931  Insulin resistance
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05221  Acute myeloid leukemia
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100409247 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100409247 (RPS6KB1)
   04371 Apelin signaling pathway
    100409247 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100409247 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100409247 (RPS6KB1)
   04152 AMPK signaling pathway
    100409247 (RPS6KB1)
   04150 mTOR signaling pathway
    100409247 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100409247 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100409247 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100409247 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100409247 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100409247 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100409247 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409247 (RPS6KB1)
   05205 Proteoglycans in cancer
    100409247 (RPS6KB1)
   05231 Choline metabolism in cancer
    100409247 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100409247 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100409247 (RPS6KB1)
   05212 Pancreatic cancer
    100409247 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100409247 (RPS6KB1)
   05226 Gastric cancer
    100409247 (RPS6KB1)
   05221 Acute myeloid leukemia
    100409247 (RPS6KB1)
   05224 Breast cancer
    100409247 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100409247 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100409247 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100409247 (RPS6KB1)
   05165 Human papillomavirus infection
    100409247 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100409247 (RPS6KB1)
   01522 Endocrine resistance
    100409247 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100409247 (RPS6KB1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100409247 (RPS6KB1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100409247 (RPS6KB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C Kinase-like Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100409247
NCBI-ProteinID: XP_002748224
Ensembl: ENSCJAG00000001416
UniProt: F7GCV0
Position
5
AA seq 525 aa AA seqDB search
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccggaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccggaaaaaatcagaccggaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagttagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagatctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagttacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatttgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagccggtcct
ggggatgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccttttaaacctctgttgcaatctgaagaggatgtaagt
caatttgattccaagtttacacgtcagacacccgttgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggc
atagagcagatggatgtgacaatgagtggggaagcatcagcaccacttccaatacgacag
ccaaactctgggccatacaaaaaacaagcttttcccatgatctctaaaaggccagagcac
ctgcgaatgaatctatga

DBGET integrated database retrieval system