KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397234Help
Entry
100397234         CDS       T03264                                 

Gene name
GABBR1
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04915  Estrogen signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100397234 (GABBR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100397234 (GABBR1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100397234 (GABBR1)
  09156 Nervous system
   04727 GABAergic synapse
    100397234 (GABBR1)
  09157 Sensory system
   04742 Taste transduction
    100397234 (GABBR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100397234 (GABBR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100397234 (GABBR1)
G protein-coupled receptors [BR:cjc04030]
 Metabotropic glutamate receptor family
  GABA
   100397234 (GABBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Sushi UPF0242 DUF3995 PKcGMP_CC COX1
Motif
Other DBs
NCBI-GeneID: 100397234
NCBI-ProteinID: XP_008992332
Ensembl: ENSCJAG00000004265
Position
4
AA seq 964 aa AA seqDB search
MLLLLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFL
PVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGG
DLPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFP
MSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP
IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTR
VKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQ
DARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTE
AVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWAL
ALALNKTSGGGGHSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWT
LIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSV
LSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRN
QFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLL
VGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYK
GLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFA
SLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRE
LEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPPEPPDRLSCDGSRVH
LLYK
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctgctgctgctactggcgccactcttccttcgcccccctggcgcg
ggcggagcgcagacccccaacgccacctcagaaggttgccagatcatacacccgccctgg
gaagggggcatcaggtaccggggcctgactcgggaccaggtgaaggctatcaacttcctg
ccggtggactatgagattgagtatgtgtgccggggggagcgcgaggtggtggggcccaag
gtccgcaagtgcctggccaacggctcctggacagatatggacacacccagccgctgtgtc
cgaatctgctccaagtcttatttgaccctggaaaatgggaaggttttcctgacgggtggg
gatctcccagctctggacggagcccgggtggatttccggtgtgaccccgacttccatctg
gtgggcagctcccggagcatctgtagtcagggccagtggagcacccccaagccccactgc
caggtgaatcgaacgccacactcagaacggcgcgcagtgtacatcggggcgctgtttcca
atgagcgggggctggccagggggccaggcctgccagcccgcggtggagatggcgctggag
gacgtgaatagccgcagggacatcctgccggactatgagctcaagctcatccaccacgac
agcaagtgtgatccaggccaagccaccaagtacctatatgagctgctctacaacgacccc
atcaagatcatcctcatgcctggctgcagctctgtctctacgctggtggctgaggctgct
cggatgtggaacctcattgtgctttcctatggctccagctcaccagccttgtcaaaccgg
cagcgttttcccactttcttccgaacgcatccatcagccacactccacaaccccacccgc
gtgaaactctttgaaaagtggggctggaagaagattgctaccatccagcaaactactgag
gtcttcacttcgactctggacgacctggaggaacgcgtgaaggaggctggaattgagatt
actttccgccagagttttttctcagatccagctgtgcctgtcaaaaacctgaagcgccag
gatgcccgaatcatcgtgggactcttctatgagactgaagctcggaaagttttttgtgag
gtgtacaaggagcgtctctttgggaagaagtatgtctggttcctcattgggtggtatgct
gacaattggttcaagatctatgacccttctatcaactgcacagtggatgagatgactgag
gcggtggaaggccatatcaccactgagattgttatgctgaatcctgccaacactcgcagc
atttctaacatgacatcccaagaatttgtagaaaaactaaccaagcgactgaaaagacac
cctgaggagacaggaggcttccaggaggcaccgctggcctacgatgccatctgggccttg
gcattggccctgaacaagacatctggaggaggcggccattccggtgtgcgcctggaggac
ttcaactacaacaatcagaccattaccgaccaaatctaccgggcaatgaactcctcgtcc
tttgagggtgtctctggccatgtggtgtttgatgccagcggctctcggatggcatggacg
cttattgagcagctgcagggtggcagctacaagaagattggctactatgacagcaccaag
gatgatctttcctggtccaaaacagataagtggattggagggtctcccccagctgaccag
accctggtcatcaagacattccgcttcctgtcacagaaactctttatctccgtctcggtt
ctctccagcctgggcattgtcctagctgttgtctgtctgtcctttaacatctacaactca
catgtccgttatatccagaactcacagcccaacctgaacaacctgactgctgtgggctgc
tcactggcattagctgctgtcttccctcttgggctggatggttatcacattgggaggaac
cagttccctttcgtctgccaggcccgcctctggctcctgggcctgggctttagtctgggc
tatggctccatgttcaccaagatttggtgggtccacacagtcttcacaaagaaggaagaa
aagaaggagtggaggaagactctggagccctggaagctgtatgccactgtgggcctgctg
gtgggcatggatgtcctcactctcgccatctggcagatcgtggaccctttgcaccggacc
attgagacatttgccaaggaggaaccaaaggaagatattgacgtctctattctgccccag
ctggagcactgcagctccaggaagatgaatacatggcttggcattttctatggttacaaa
gggctgctgctgctgctgggaatctttcttgcttacgagactaagagtgtgtccactgag
aagatcaacgatcaccgggccgtgggcatggctatctacaatgtggcagtcctgtgcctc
atcactgcccctgtcaccatgattctgtccagccagcaggatgcagcctttgcctttgcc
tctcttgccatagttttctcctcctatattactcttgttgtgctctttgtgcccaagatg
cgcaggctgatcacccgaggggaatggcagtcagaggcacaggacaccatgaagacaggg
tcatcgaccaacaacaacgaggaggagaagtcccggctgttggagaaggagaaccgtgaa
ctggaaaagatcattgctgagaaagaggagcgtgtctctgaactgcgccatcaactccag
tctcggcagcagctccgctcccggcgccacccaccgacacccccggacccctctgggggt
ttgcccaggggaccccctgagcctcccgaccggcttagctgtgatggtagtcgcgtgcat
ttgctttataagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401881Help
Entry
100401881         CDS       T03264                                 

Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1-like
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04915  Estrogen signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100401881
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100401881
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100401881
  09156 Nervous system
   04727 GABAergic synapse
    100401881
  09157 Sensory system
   04742 Taste transduction
    100401881
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100401881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100401881
G protein-coupled receptors [BR:cjc04030]
 Metabotropic glutamate receptor family
  GABA
   100401881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 100401881
NCBI-ProteinID: XP_008989005
Ensembl: ENSCJAG00000032642
Position
Un
AA seq 192 aa AA seqDB search
MLLLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLP
VDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGD
LPALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQGEGNGCLHAADEDACVRMGV
GWEWMMGKNGEL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctgctgctactggcgccactcttccttcgcccccctggcgcgggc
ggagcgcagacccccaacgccacctcagaaggttgccagatcatacacccgccctgggaa
gggggcatcaggtaccggggcctgactcgggaccaggtgaaggctatcaacttcctgccg
gtggactatgagattgagtatgtgtgccggggggagcgcgaggtggtggggcccaaggtc
cgcaagtgcctggccaacggctcctggacagatatggacacacccagccgctgtgtccga
atctgctccaagtcttatttgaccctggaaaatgggaaggttttcctgacgggtggggat
ctcccagctctggacggagcccgggtggatttccggtgtgaccccgacttccatctggtg
ggcagctcccggagcatctgtagtcagggccagtggagcacccccaagccccactgccag
ggtgaggggaacggctgcctgcatgcagctgatgaggacgcttgtgtgaggatgggagtg
gggtgggaatggatgatgggaaagaatggggagctataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412651Help
Entry
100412651         CDS       T03264                                 

Gene name
GABBR2
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04915  Estrogen signaling pathway
cjc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100412651 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100412651 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100412651 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    100412651 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    100412651 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100412651 (GABBR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100412651 (GABBR2)
G protein-coupled receptors [BR:cjc04030]
 Metabotropic glutamate receptor family
  GABA
   100412651 (GABBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor Peripla_BP_6 GBR2_CC Cation_ATPase_C MYCBPAP
Motif
Other DBs
NCBI-GeneID: 100412651
NCBI-ProteinID: XP_017833104
Position
1
AA seq 1007 aa AA seqDB search
MVSPRSSGQPGXVPPPPPPPARLLLLLLLPLLLLLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHVEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMVVIGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNV
QFCIVALVIIFCSTITLCLVFVPKVRARARAPPPGLCPPTPARGLLGFLDSLKGLPIPFL
TGERKDHLGPFQQTGYPWCSILLGVQSAPRHCIPALADAASSLVFPSPIPPDPPQSPADH
DTVFFTLQCNYHIYVMYNKRRESERKLEERLDKDLEEVTMQLQDTPEKTTYIKQNHYQEL
NDILNLGNYTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPTEDINSPEHIQRRLSL
QLPILHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggtttccccgcggagctccgggcaacccgggtaagtgccgccgccgccaccgccgccc
gcgcgcctgctgctgctcctgctgctgccgctgctgctgcttctggcgcccggggcctgg
ggctgggcgcggggcgccccccggccgccgcccagcagcccgccgctctccatcatgggc
ctcatgccgctcaccaaggaggtggccaagggcagcatcgggcgcggtgtgctccccgcc
gtagaactggccatcgagcagatccgcaacgagtcactcctgcgcccctacttcctcgac
ctgcggctctatgacaccgagtgcgacaatgcaaaagggttgaaagccttctacgatgca
ataaaatacgggccgaatcacttgatggtgtttggaggcgtctgtccatctgtcacgtcc
atcattgcagagtccctccaaggctggaatctggtgcagctttcctttgctgcaaccacg
cctgttctagccgataagaaaaaatacccttatttctttcggactgtcccatcagacaat
gcggtgaatccagccattctgaagttgctcaagcactaccagtggaagcgcgtgggcacg
ctgacgcaagacgttcagaggttctctgaggtgcggaacgacctgactggggttctgtat
ggcgaggacattgagatttcagatactgagagcttctccaatgatccctgtaccagtgtc
aaaaagctgaaggggaatgatgtgcggatcatccttggccagtttgaccagaatatggca
gcaaaagtgttctgttgtgcatatgaggagaacatgtatggtagtaaataccagtggatc
atcccaggctggtacgagccttcctggtgggaacaggtgcacgtggaagccaactcatcc
cgctgcctccggaagaatctgcttgctgccatggagggctacattggtgtggacttcgag
cccctgagctccaagcagatcaagaccatctcaggaaagactccacagcagtatgagaga
gagtacaacaacaagcggtcaggcgtggggcccagcaagttccacgggtacgcctacgat
ggcatctgggtcattgccaagacgctgcagagggccatggagacactgcatgccagcagc
cggcaccagcggatccaggacttcaactacacagaccacacgctgggcaggatcatcctc
aatgccatgaacgagaccaacttcttcggggtcacgggtcaagttgtgttccggaatggg
gagagaatggggaccattaaatttactcaatttcaagacagcagggaggtaaaggtggga
gagtacaacgctgtggccgacacactggagatcatcaatgacaccatcaggttccaagga
tctgaaccaccaaaagacaagaccattatcctggagcagctgcggaagatctccctacct
ctctacagcatcctctctgccctcaccatccttgggatgatcatggccagtgcttttcta
ttcttcaacatcaagaaccggaatcagaagcttataaagatgtcgagcccatacatgaac
aaccttattatccttggagggatgctctcctatgcgtccatatttctctttggccttgat
ggatcctttgtttctgagaagacctttgaaacactttgcaccgtcaggacctggattctc
accgtgggctacacgaccgcttttggggccatgtttgcaaagacctggagagtccacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaaactgcttgtgatc
gtggggggcatgctgctaatcgacctgtgcatcctgatctgctggcaggccgtggacccg
ctgcgaaggacagtggagaagtacagcatggagccggacccagcaggacgggatatctcc
attcgtcctctcctggagcactgtgagaacacccatatgaccatctggcttggcattgtc
tatgcttacaagggacttctcatggtagttatcggttgtttcttagcttgggagacccgc
aacgtcagcatccctgcactcaacgacagcaagtacattgggatgagcgtctacaacgtg
gggatcatgtgcatcatcggggccgccgtctcctttctgacccgggaccagcccaacgtg
cagttctgcatcgtggctctagtcatcatcttctgcagcaccatcaccctctgcctggtg
ttcgtaccgaaggtacgggcacgggcccgggccccaccacctggcctctgccctccaact
ccagcacggggattgctgggttttcttgattctctaaagggtttacccattcctttctta
acaggggagaggaaagaccacctgggtccatttcagcaaacaggctacccatggtgctcc
atcctcctgggcgtgcagtcagcccccaggcactgcattcctgcgttggcagacgctgct
tcttccctggtgtttccttcccccatccctccagatcctcctcagagcccagcagaccat
gacaccgtgtttttcactctccagtgcaactaccacatctatgtgatgtacaacaagaga
agagaaagtgaaaggaaacttgaggagagactggataaagacttggaagaggtcaccatg
cagctgcaggacacgccagaaaagaccacctacattaaacagaaccactaccaagagctc
aatgacatcctcaacctgggaaactacactgagagcacagatggaggaaaggccatttta
aaaaatcacctcgatcaaaatccccagctacagtggaacacaacagagccctctcgaaca
tgcaaagatcctacagaagacataaactctccagaacacatccagcgacggctgtccctc
cagctccccatcctccaccacgcctacctcccatccatcggaggcgtggacgccagctgc
gtcagcccctgcgtcagccccaccgctagcccccgccatagacatgtgccaccctccttc
cgagttatggtctcgggcctgtaa

DBGET integrated database retrieval system