KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397247Help
Entry
100397247         CDS       T03264                                 

Gene name
ZFP36
Definition
(RefSeq) ZFP36 ring finger protein
  KO
K15308  tristetraprolin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397247 (ZFP36)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397247 (ZFP36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100397247 (ZFP36)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100397247 (ZFP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 100397247
NCBI-ProteinID: XP_002762143
Ensembl: ENSCJAG00000014156
Position
22
AA seq 332 aa AA seqDB search
MANRYTMDLTAIYESLLSLNADAPVPSDHGETESSPGWGSSGLWSLSPSDSSPSGVISRL
PGRSTSLVEGRSFGWVPPPPGFAPLAPHLGPELSPSPTSPTATPTTSSRYKTELCRTFSE
SGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAA
PGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSCSFSPSSSPPPPGDLPLSPSAFSAA
PGTPVARRDPTPVCCPSCRRATPMSVWGGALGGLVRSPSVQSLESDPDEYASSGSSLGGS
DSPVFEAGIFAPPQPTAAPRRLPIFNRISVSE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccgctacaccatggatctcaccgccatctacgagagcctcctgtcgctgaac
gctgatgcgcccgtgccatctgaccacggagagactgagtccagcccaggctggggctcc
tcgggactctggagcctgagcccctctgactccagcccgtctggggtcatctctcgcctg
cctggccgctccaccagcctggtggagggccgcagctttggctgggtgcccccaccccct
ggcttcgcaccgctggctccccacctgggccccgagctgtcaccctcacccacctcgccc
acagccacccccaccacctcctcccgctacaagactgagctgtgtcggaccttctcagag
agtgggcgctgccgctatggggccaaatgccagtttgcccatggcctgggcgagctgcgc
caagccaatcgccaccccaagtacaagacggaactctgccacaagttctacctccagggc
cgctgcccctacggctctcgctgccacttcatccacaaccccagcgaagacctggcagcc
ccgggccaccctcctgtgcttcgccagagcatcagtttctctggcctgccctccggccgc
cggacctcaccaccaccgccaggcctggctggcccttccctgtcctgctccttctcgccc
tccagctccccgccaccacctggggaccttccactgtcaccctctgccttctctgctgcc
cctggtacccctgtggctcgaagagaccccaccccggtctgttgcccctcctgccgaagg
gccacccctatgagcgtctgggggggggccttgggtggcctggttcgaagcccctctgta
caatccttggaatctgaccctgatgaatacgccagcagcggcagcagcttggggggctct
gactctccagtcttcgaggcggggatttttgcaccaccccagcccacggcagccccccgg
cgactccccattttcaatcgcatctctgtttctgaatga

DBGET integrated database retrieval system