KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397393Help
Entry
100397393         CDS       T03264                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box O1
  KO
K07201  forkhead box protein O1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04068  FoxO signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04218  Cellular senescence
cjc04910  Insulin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04922  Glucagon signaling pathway
cjc04931  Insulin resistance
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100397393 (FOXO1)
   04152 AMPK signaling pathway
    100397393 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100397393 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100397393 (FOXO1)
   04922 Glucagon signaling pathway
    100397393 (FOXO1)
   04919 Thyroid hormone signaling pathway
    100397393 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    100397393 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    100397393 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397393 (FOXO1)
   05202 Transcriptional misregulation in cancer
    100397393 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100397393 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100397393 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100397393 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100397393 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100397393 (FOXO1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100397393 (FOXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 100397393
NCBI-ProteinID: XP_008996417
UniProt: U3FDL3
Position
5
AA seq 654 aa AA seqDB search
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSSSATSSPAPSGGAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEENEDFPQAPGSVAAAVAAAAVAAAGGLCGDFQGPEAGCLHPA
PPQPPPPGPLPQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRL
TLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
EGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGS
HSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPS
LSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSQNY
QKYTYGQSSMSPLPQMPMQTLQDSKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVD
PAVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHTQQTSAVNGRALPH
TVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMNALGGYSSVSSCNGYGRMGLLHQEKLPSD
LDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccagttcggccacctcc
agcccggcgccgtcgggcggcgcggctgccaaccccgacgccgcggcgggcctgccctcg
gcctcggcggccgctgtcagcgctgacttcatgagcaacctgagcctgctggaggagaac
gaggacttcccgcaggcgcccggctccgtggcggcggcggtggcggcggctgccgtggcc
gccgccgggggactgtgcggggacttccagggcccggaggcgggctgcctgcacccagcg
ccgccgcagcccccgccgcccgggccgctgccgcagcacccaccagtgccccccgccgcc
gccgggccgctcgcgggacagccgcgcaagagcagctcgtcccgccgcaacgcgtggggc
aacctgtcctacgctgacctcatcaccaaggccatcgagagttcggcggagaagcggctc
acgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataagggt
gacagcaacagctccgcgggctggaagaattcaattcgtcataatctgtccttacacagc
aagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaatcca
gagggcggcaagagcgggaaatctcccaggagaagagctgcatccatggacaacaacagc
aaatttgctaaaagccgaagccgagctgccaagaagaaagcatccctccagtctggccag
gagggtgccggggacagccctggatcacagttttccaaatggcctgcaagccctggctct
cacagcaacgatgactttgataactggagtacatttcgccctcgaactagctcaaatgct
agtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaaggg
gatgtgcattctatggtgtacccgccatctgctgcaaagatggcctctactttgcccagt
ctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaaccttctc
tcatcaccaacatcattaactgtttcgacccagtcctcacctggcactatgatgcagcag
acaccatgctactcatttgcaccaccaaacaccagtctgaattcgcccagccaaaactac
caaaagtacacatatggccaatccagcatgagccctttgccccagatgcctatgcaaaca
cttcaggacagtaagtcaagttatggagggatgagtcagtataactgtgcacctggactc
ttgaaggagttgctgacttctgattctcctccccataatgacattatgacaccagttgat
cctgcggtagcccagcccaacagccgggtcctgggccagaacgtcatgatgggccctaat
tcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccagctcc
catacccaccctggacacactcagcagacatctgcagttaacgggcgtgccctgccccac
acagtaagcaccatgccccacacttcgggtatgaaccgcctgacccaagtgaagacacct
gtacaagtgcctctgcctcaccccatgcagatgaatgccctggggggctactcctcagtg
agcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagtgac
ttggatggcatgttcattgagcgcttggactgtgatatggaatccatcattcggaatgac
ctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagcttc
ccacacagtgtcaagacgacgacacatagctgggtgtcaggctga

DBGET integrated database retrieval system