KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397418Help
Entry
100397418         CDS       T03264                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04150  mTOR signaling pathway
cjc04210  Apoptosis
cjc04215  Apoptosis - multiple species
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc05010  Alzheimer disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05142  Chagas disease (American trypanosomiasis)
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100397418 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    100397418 (TNFRSF1A)
   04668 TNF signaling pathway
    100397418 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    100397418 (TNFRSF1A)
   04150 mTOR signaling pathway
    100397418 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397418 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100397418 (TNFRSF1A)
   04215 Apoptosis - multiple species
    100397418 (TNFRSF1A)
   04217 Necroptosis
    100397418 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100397418 (TNFRSF1A)
  09158 Development
   04380 Osteoclast differentiation
    100397418 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100397418 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    100397418 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100397418 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100397418 (TNFRSF1A)
   04931 Insulin resistance
    100397418 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100397418 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397418 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    100397418 (TNFRSF1A)
   05164 Influenza A
    100397418 (TNFRSF1A)
   05160 Hepatitis C
    100397418 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    100397418 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    100397418 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397418 (TNFRSF1A)
   05165 Human papillomavirus infection
    100397418 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100397418 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    100397418 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100397418 (TNFRSF1A)
   04090 CD molecules [BR:cjc04090]
    100397418 (TNFRSF1A)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100397418 (TNFRSF1A)
CD molecules [BR:cjc04090]
 Proteins
  100397418 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 100397418
NCBI-ProteinID: XP_003733759
Ensembl: ENSCJAG00000000674
UniProt: F6UYQ7
Position
9
AA seq 454 aa AA seqDB search
MGLPIVTDLLLPLVLLVLLVGIYPSGVIGLVPHLGDKEKRDSACPQGKYIHPQNNSVCCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCREEVGQVEISPCTVD
RDTECGCGKNQYRHYFNENFFQCVNCSLCLNGTIQIPCQEKQNTVCNCHAGFFLCENKCV
SCSKCKKDLDCTKLCLPPTEGIKGPEDPGTTVLLPLVIFFGLCILSLFIGLMYRHQRWKP
KLYSIVCGKPTPKKEGEPDGTTSKPLAPTPSFSPSPGCISTQGFSPMPNSIFTSSSIYTP
GDCPNFAAPHREMAPPYQGADPILAPALASALIPTPLQKWKDSAHQPQSVDTDDPATLYA
VVDGVPPLRWKEFVRRLGLSDHEIERLELQNGRCLREAHYSMLAAWRRRTPRREATLELL
GRVLRDMDLLGCLEDIEEALCGPTTLPPAPDLLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccatcgtgactgacctgctgctgccactggtgctcctggtgctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctcggggacaaggagaagaga
gatagtgcgtgtccccaaggaaaatatatccaccctcaaaataattctgtttgctgtacc
aagtgccacaaaggaacctacttgtacaacgactgtccaggcccagggcaggacacggac
tgcagggagtgcgagagcggctctttcaccgcttcagagaaccacctcagacactgcctc
agctgctccaaatgccgagaggaagtgggccaggtggagatctctccctgcaccgtggac
cgggacacggagtgtggctgtgggaagaaccagtaccggcattattttaatgaaaacttt
ttccaatgtgtcaactgcagcctctgcctcaatggcactatacagatcccttgccaggag
aaacagaacaccgtgtgcaactgtcatgcagggttctttctatgtgaaaacaagtgtgtc
tcctgtagtaaatgtaagaaagacctggactgcacgaagttgtgcctaccccccactgag
ggtattaagggccctgaggacccaggcaccacagtgctgttgcccctggtcatcttcttt
ggtctttgcattttatccctcttcatcggtttaatgtatcgtcatcaacgatggaagccc
aagctctactccattgtttgtgggaaaccaacgcctaaaaaagagggggagcctgacgga
actacttctaagcccctggccccaaccccaagcttcagtccctctccaggctgcatctcc
acccagggcttcagtcccatgcccaattccatcttcacctccagctccatctatacccct
ggtgactgtcccaactttgcggctcctcacagagagatggcaccaccctaccagggtgct
gaccccatcttggccccagccctcgcctctgccctcatccccaccccgcttcagaagtgg
aaggacagcgctcaccagccacagagcgtagacaccgacgaccccgcgacgctgtacgct
gtggtggacggtgtgcccccgctgcgctggaaggagttcgtgcggcgcctagggctgagc
gaccacgagatcgagcgactggagctgcagaacgggcgttgcctccgagaagcgcactac
agcatgttggcggcctggaggcggcgcacgccgcggcgcgaggccacgctggagctgctg
ggccgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcgctg
tgcggccccaccaccctcccgcccgcgcctgatcttctcagatga

DBGET integrated database retrieval system