KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397452Help
Entry
100397452         CDS       T03264                                 

Gene name
CCL19
Definition
(RefSeq) C-C motif chemokine ligand 19
  KO
K05512  C-C motif chemokine 19
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100397452 (CCL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397452 (CCL19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100397452 (CCL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397452 (CCL19)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100397452 (CCL19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100397452
NCBI-ProteinID: XP_002743087
Ensembl: ENSCJAG00000008935
UniProt: F7BQ31
Position
1
AA seq 98 aa AA seqDB search
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQNPIPGYIIRNFRYLLIKDGCRVPAV
VFTTVRGRQLCAPLDQPWVERIIRRLQRTSAKMKRRSS
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctactggccctcagcctgctggttctctggacttccccagccccaactctg
agtggcaccaacgatgctgaagactgctgcctgtctgtgacccagaaccctatcccaggg
tacatcatcaggaacttccgctaccttctcatcaaggatggctgcagggtgcccgctgtg
gtgttcaccacagtcaggggccgccagctctgtgcacccctagaccagccctgggtagaa
cgtatcatccggagactgcagaggacctcagccaagatgaagcgccgcagcagttaa

DBGET integrated database retrieval system