KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397484Help
Entry
100397484         CDS       T03264                                 

Gene name
TNF, TNF-a, TNF-alpha, TNFA, TNFSF2
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01523  Antifolate resistance
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04150  mTOR signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04350  TGF-beta signaling pathway
cjc04380  Osteoclast differentiation
cjc04612  Antigen processing and presentation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04625  C-type lectin receptor signaling pathway
cjc04640  Hematopoietic cell lineage
cjc04650  Natural killer cell mediated cytotoxicity
cjc04657  IL-17 signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04920  Adipocytokine signaling pathway
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc04940  Type I diabetes mellitus
cjc05010  Alzheimer disease
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05140  Leishmaniasis
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05144  Malaria
cjc05145  Toxoplasmosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05205  Proteoglycans in cancer
cjc05310  Asthma
cjc05321  Inflammatory bowel disease (IBD)
cjc05322  Systemic lupus erythematosus
cjc05323  Rheumatoid arthritis
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
cjc05410  Hypertrophic cardiomyopathy (HCM)
cjc05414  Dilated cardiomyopathy (DCM)
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100397484 (TNF)
   04350 TGF-beta signaling pathway
    100397484 (TNF)
   04064 NF-kappa B signaling pathway
    100397484 (TNF)
   04668 TNF signaling pathway
    100397484 (TNF)
   04071 Sphingolipid signaling pathway
    100397484 (TNF)
   04150 mTOR signaling pathway
    100397484 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397484 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100397484 (TNF)
   04217 Necroptosis
    100397484 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100397484 (TNF)
   04620 Toll-like receptor signaling pathway
    100397484 (TNF)
   04621 NOD-like receptor signaling pathway
    100397484 (TNF)
   04622 RIG-I-like receptor signaling pathway
    100397484 (TNF)
   04625 C-type lectin receptor signaling pathway
    100397484 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    100397484 (TNF)
   04612 Antigen processing and presentation
    100397484 (TNF)
   04660 T cell receptor signaling pathway
    100397484 (TNF)
   04657 IL-17 signaling pathway
    100397484 (TNF)
   04664 Fc epsilon RI signaling pathway
    100397484 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100397484 (TNF)
  09158 Development
   04380 Osteoclast differentiation
    100397484 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100397484 (TNF)
  09163 Immune disease
   05310 Asthma
    100397484 (TNF)
   05322 Systemic lupus erythematosus
    100397484 (TNF)
   05323 Rheumatoid arthritis
    100397484 (TNF)
   05321 Inflammatory bowel disease (IBD)
    100397484 (TNF)
   05330 Allograft rejection
    100397484 (TNF)
   05332 Graft-versus-host disease
    100397484 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100397484 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    100397484 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100397484 (TNF)
   05410 Hypertrophic cardiomyopathy (HCM)
    100397484 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    100397484 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100397484 (TNF)
   04940 Type I diabetes mellitus
    100397484 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100397484 (TNF)
   04931 Insulin resistance
    100397484 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100397484 (TNF)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100397484 (TNF)
   05134 Legionellosis
    100397484 (TNF)
   05152 Tuberculosis
    100397484 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397484 (TNF)
   05170 Human immunodeficiency virus 1 infection
    100397484 (TNF)
   05164 Influenza A
    100397484 (TNF)
   05161 Hepatitis B
    100397484 (TNF)
   05160 Hepatitis C
    100397484 (TNF)
   05168 Herpes simplex virus 1 infection
    100397484 (TNF)
   05163 Human cytomegalovirus infection
    100397484 (TNF)
   05169 Epstein-Barr virus infection
    100397484 (TNF)
   05165 Human papillomavirus infection
    100397484 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100397484 (TNF)
   05144 Malaria
    100397484 (TNF)
   05145 Toxoplasmosis
    100397484 (TNF)
   05140 Leishmaniasis
    100397484 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    100397484 (TNF)
   05143 African trypanosomiasis
    100397484 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100397484 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397484 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100397484 (TNF)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100397484 (TNF)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Cytokines
   100397484 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100397484
NCBI-ProteinID: NP_001244190
Ensembl: ENSCJAG00000003109
UniProt: Q19LH4
Position
4
AA seq 232 aa AA seqDB search
MSTETMIQDVELAEEALPKTRGPQGSKRRLFLSLFSFLLVAGATALFCLLHFGVIGPQKD
ELSKDFSLISPLALAVRSSSRIPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRD
NQLVVPSEGLYLVYSQVLFKGQGCPSNFMLLTHSISRIAVSYQAKVNLLSAIKSPCQRET
PQGAKTNPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDLAESGQVYFGIIGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaccatgatccaggacgtggagctggccgaggaggcactccccaagacc
cgggggccccagggctccaagcgacgcttgttcctcagcctcttctccttcctgcttgta
gcaggtgccaccgcactcttctgcctgctgcacttcggcgtgatcggcccccagaaggac
gagctctccaaggacttctctctaatcagccctctggccctggcagtcagatcatcttct
cgaatcccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgaggggcag
ctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgagagat
aaccagctggtggtgccatcagaggggctgtacctcgtctactcccaggtcctcttcaag
ggccaaggctgcccctccaactttatgctcctcacccacagcatcagccgcatcgctgtc
tcctaccaggccaaggtcaacctcctctctgccatcaagagcccctgccagagggagacc
ccacagggcgctaagaccaatccctggtatgagcccatctacctgggaggggtcttccag
ctggagaagggtgatcgactcagcgctgagatcaatctgcctgactatctcgacttggct
gagtctgggcaggtctactttgggatcattggcctgtga

DBGET integrated database retrieval system