KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397497Help
Entry
100397497         CDS       T03264                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00562  Inositol phosphate metabolism
cjc01100  Metabolic pathways
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04070  Phosphatidylinositol signaling system
cjc04072  Phospholipase D signaling pathway
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04670  Leukocyte transendothelial migration
cjc04722  Neurotrophin signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04919  Thyroid hormone signaling pathway
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100397497 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100397497 (PLCG1)
   04015 Rap1 signaling pathway
    100397497 (PLCG1)
   04012 ErbB signaling pathway
    100397497 (PLCG1)
   04370 VEGF signaling pathway
    100397497 (PLCG1)
   04064 NF-kappa B signaling pathway
    100397497 (PLCG1)
   04066 HIF-1 signaling pathway
    100397497 (PLCG1)
   04020 Calcium signaling pathway
    100397497 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100397497 (PLCG1)
   04072 Phospholipase D signaling pathway
    100397497 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100397497 (PLCG1)
   04660 T cell receptor signaling pathway
    100397497 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100397497 (PLCG1)
   04659 Th17 cell differentiation
    100397497 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100397497 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100397497 (PLCG1)
   04670 Leukocyte transendothelial migration
    100397497 (PLCG1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100397497 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100397497 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100397497 (PLCG1)
  09158 Development
   04360 Axon guidance
    100397497 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397497 (PLCG1)
   05206 MicroRNAs in cancer
    100397497 (PLCG1)
   05205 Proteoglycans in cancer
    100397497 (PLCG1)
   05231 Choline metabolism in cancer
    100397497 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100397497 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100397497 (PLCG1)
   05214 Glioma
    100397497 (PLCG1)
   05223 Non-small cell lung cancer
    100397497 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100397497 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100397497 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397497 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100397497 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100397497 (PLCG1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100397497 (PLCG1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100397497 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100397497 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 GDPD PH_12
Motif
Other DBs
NCBI-GeneID: 100397497
NCBI-ProteinID: XP_008994187
Ensembl: ENSCJAG00000018013
Position
5
AA seq 1296 aa AA seqDB search
MAGAASPCANGCGPSAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGVDKIEGAQXVLDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRL
KTLSLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDL
KNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEAST
LRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFVDE
FVTFLFSKENSVWNSQLDAVCPDTMNNPSFHYWISSSHNTYLTGDQFSSESSLEAYARCL
RMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHC
SIAQQRNMAQYFKKVLGDTLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPT
SVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKE
VSSSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTL
SFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPV
PQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRV
QQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEG
RNPGFYVEANPMPTFKVQLRPLALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGG
KKQLWFPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLF
VFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLSEGKMMERRKKIALELSE
LVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKG
QRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFD
PFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNG
LNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNN
YSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQ
QPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaacggctgcgggcccagcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactct
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgtcgacaagatcgagggggcccagtaagtgcttgatattcgagaa
atcaaggagatccgcccagggaagacctcacgggactttgatcgctatcaagaggacccc
gctttccggccggaccagtcacactgctttgtcattctctatggaatggaattccgcctg
aagaccctgagcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggctta
acttggctgatggaggatacattacaggcacccacacccctgcagattgagaggtggctc
cggaagcaattttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctg
aagaacatgctgtcacaggtcaattaccgggtccccaacatgcgcttcctccgagagcgc
ctgacggacctggagcagcgcagcggggacatcacctatgggcagtttgctcaactgtac
cgcagcctcatgtacagcgcccagaagacgatggatctccccttcttggaagccagtact
ctgagggctggggagcggccagagctttgccgagtgtcccttcctgagttccagcagttc
ctccttgactaccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatg
ctcagcttcctccgagaccccttgcgagagattgaggagccatactttttcgtggatgag
tttgtcaccttcctgttctccaaagagaacagtgtgtggaactcgcagctggacgctgta
tgcccggacaccatgaacaacccctctttccactactggatctcctcctcccacaacacg
tacctgaccggggaccagttctccagtgagtcctccctggaagcctacgctcgctgcctg
cggatgggctgtcgctgcattgagttggactgctgggatggtccagatgggatgccagtc
atttaccatgggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatc
aaggagcatgcctttgtggcctcagagtacccagtcatcctttccatcgaggaccactgc
agcattgcccagcagagaaacatggcccagtacttcaagaaggttctgggggacacactc
ctcaccaagcccgtggatatctctgccgatgggctcccctcacccaaccagcttaagaga
aagatcctcatcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctaca
tctgtgatgtactctgagaacgacatcagcaactccatcaagaatggcatcctctatctg
gaggaccctgtgaaccacgaatggtatccccactacttcgttctgaccagcagcaagatc
tactactctgaagagaccagcagtgaccagggcaatgaggatgaggaggagcccaaggag
gtcagcagcagcacagagctgcactccaatgagaaatggttccatgggaagcttggggca
gggcgtgatgggcggcacatcgctgagcgcctgcttactgagtactgcatcgagaccggg
gcccctgacggctccttcctcgttcgagagagtgagaccttcgtgggcgactacacgctc
tctttctggcggaacgggaaagttcagcactgccgtatccactcccggcaagatgctggg
acccccaagttcttcttgacagacaacctcgtctttgattccctctatgacctcatcaca
cactaccagcaggtgcccctgcgctgcaatgagtttgagatgcgactttcagaacctgtt
ccacagaccaacgcccatgagagcaaagagtggtaccatgcgagcctgactagagcacag
gctgagcacatgctaatgcgtgtcccccgtgatggggccttcctggtgcggaagcggaat
gagcccaactcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtc
cagcaggagggacagactgtgatgctagggaactcagagttcgacagccttgttgacctc
atcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgttatcccatcaat
gaggaggcactggagaagattggcacagctgagcctgactacggggccctgtatgaggga
cgcaaccctggcttctacgtagaggcaaaccctatgccaactttcaaggtacagctcagg
cctctggccctctttgactacaaagcccagagggaagacgagctgaccttcaccaagagt
gctatcatccagaacgtggagaagcaagagggaggctggtggcgaggtgactatggaggg
aagaagcaactgtggttcccatcaaactatgtggaagagatggtcaaccccgtggccctg
gagccagagagggagcacttggacgagaacagccccctaggggacttgctgcggggggtc
ttggatgtaccagcttgtcagattgccatccgtcctgagggcaagaacaaccggctcttc
gtcttctccatcagcatggcatcagtggcccactggtccctggatgttgctgcagactca
caggaggagctgcaggactgggtgaaaaagattcgtgaagtggcccagaccgcagatgcc
aggctctctgaggggaagatgatggaacggaggaagaagattgccctggagctctctgag
cttgtcgtctactgccggcctgttcccttcgatgaagagaagattggcacagaacgtgct
tgctaccgggacatgtcgtccttcccggaaaccaaggctgagaaatacgtgaacaaggcc
aaaggcaagaagttccttcagtacaatcgactgcagctctcccgcatctaccccaagggc
cagcgactggattcctccaactatgatcctttgcccatgtggatctgtggcagccagctc
gtggccctcaacttccagacccctgacaagcctatgcagatgaaccaggccctcttcatg
acgggccggcactgtggctatgtgctgcagccaagtaccatgcgggacgaggccttcgac
ccctttgacaagagcagcctccgcgggctggagccatgtgccatctgtattgaggtgctg
ggggcccgacatctgccgaagaatggccgaggcattgtgtgtccttttgtggagattgag
gtggctggagctgagtatgacagcaccaagcagaagacagagtttgtggtggacaatgga
ctcaaccctgtatggccggccaagcccttccacttccagatcagtaaccctgaatttgcc
tttctgcgtttcgtggtgtatgaggaagacatgtttagtgaccagaatttcctggctcag
gctactttcccagtaaaaggcctgaagacaggatacagagcagtgcctttgaagaacaac
tacagcgaggacctggaattggcctccctgctgatcaagattgacattttccctgccaag
caagagaatggtgacctcagtcccttcagtggtacatccctgcgggagcgaggctcagat
gcctcaggccagctgtttcatggccgagcccgggaaggctcctttgagtcccgctaccag
cagccatttgaggacttccgcatctcccaggagcatctcgcagaccattttgacagtcga
gaacgaagggccccaagaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system