KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397509Help
Entry
100397509         CDS       T03264                                 

Gene name
BRCA2
Definition
(RefSeq) BRCA2, DNA repair associated
  KO
K08775  breast cancer 2 susceptibility protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
cjc05200  Pathways in cancer
cjc05212  Pancreatic cancer
cjc05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100397509 (BRCA2)
   03460 Fanconi anemia pathway
    100397509 (BRCA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397509 (BRCA2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100397509 (BRCA2)
   05224 Breast cancer
    100397509 (BRCA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100397509 (BRCA2)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100397509 (BRCA2)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100397509 (BRCA2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100397509 (BRCA2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100397509 (BRCA2)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100397509 (BRCA2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100397509 (BRCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower 7TMR-HDED
Motif
Other DBs
NCBI-GeneID: 100397509
NCBI-ProteinID: XP_002749005
Ensembl: ENSCJAG00000018462
Position
5
AA seq 3408 aa AA seqDB search
MPIGSKERPTFFEIFKTRCNKADIGPISLNWFEELSSEASPCNSEPTEESEHKISVYEPN
IFKTPQRKPSYNQLASTPIIFKEQGLTLPPYQSPVKELDKFRLDLGRKVPNGRHKSPRTV
KAKMDQTDDVTCPLLNSCLSESPVLQCTHVTPQRDKSVVCGSLFHTPKFVKGHQTPKHIS
ESLGAEVDPDMSWSSSLATPPSLSSTVLIVRNEEASETVFPHDTTAIVKCCFSNHDESLK
KNSRFIPSVTDSENTNQREATCHGFGKTLGNSFGKVNSCKDYIGKSMPNVLEDEVYETIV
DTSEEDSFSLCFSKCRKRNLQKVRTEKTRKKIYEANTDECEKSKSQVKEKYSFVSELEPN
DTDPLDSNVANQKLFESASDKISKEVVPSLAYERSQLTLSGLHGTQMEIIPLLHISSCDQ
SNSEKNLLDAENERKKDFLTSENSLSDISSLPKSEKPLNEERMVNKKDEEQHLESDGDHI
LAVKQATSGNPLVASSFQGIKKSIFRIRESPKETLSASFSGSMSDPNVKKETEASESRLE
IHTVCSWKEDTLCPDSIDNGSWPASITQTSVVLKNAGLISTLKKKTNKFIYAIHDETSYQ
GKKIQKDQKSEVINSSSQFEANAFEAPLTFANTDSGLLHPSVQRNCSQIDSGEPTLSLTS
SSGTILRKCTRNETCCNNIIISQDLDYKEAKCNKEKTQLFITPEADSLSCLQEGQCKNYP
KSKEVSDIKEEVLATACHLAQHSEVEYCDTDFQSQKTILHDHENASSLILTPAFKDVLSG
KESYRISDELKCNNCEADFELIKNISMENNQDVHALNENSKNIELLPPEKYIIVASPSRY
VQFNQNTNLRVIQKDQEETTLISKMTVSPDSEELLSDNENNFVFQVASERNNFALESTEE
LHEADLTCVNKPNFENSTMVLHADIVDKQATQVSIKKDLDSSNKVYYLAEEKKNSVKQHL
EMTLGQDIKSDISLNIDKIPNKNNDYKDKWAGLLHPISNHSFGGSFRTASNKEIKLSEHN
IKKSKMLFRDIEEQYPTSSACVEIVNTLALDNQKKLSKPQSIKTVSAHVQSSVVGFDCKN
SLTTPQMLFSKEDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQYRKPSYILQNNMFE
VPENQMTILNSTSEEYRDADLHLVMNAPSIGQVDSRKQFEGTVGIKQKFAVLLKNDCNKS
ASGYLTDADEVELRGFYSAHGVKLNVSTEALQKAVKLFSDIESISEETSAAVDPISLSSS
KCHDSVVSVFKIENHDEKNNECQLILQNNIEMTTGTFVEEITENYKKNIENEDKHTATSR
NTHNLEFDGSDSSKNDTVHIHKDENDLPLTNQHNIYLKLSGQFMKEGNTQIKEDLSDLTF
LEVVKAQETCHGNTSNKEQLTATKMEQNIKDVGTFDLSFQTASGKNISISKESFNKVVNF
FDQKPEELHNFSLNSKLHSDIRKNKMDILSYEETDIVKNKTLKESIPVGTGNQLVTIQEQ
PKSNIKKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKGQDTGEITSFSHQGAKTLK
YREAYKDLELVRETVEIATTRKHEEMQNSLSNDKNLVSIETVVPPKPLSDNLYRHTESLK
TSEGNFLKVKEHENVEKETAESPATCYRNQSPYSVIENSALAFYTYCSRKTSVSQASSLE
AKQWLREGEFDDQPENINTVDFVGNSLYENNSNNTITEGNKNHLSEKQDTYLSNSSMSNS
YSYHSDEVYNDSGYRSKNNLDSGIEPVVKNVEDQKNTRSSKVTFNVKDANAYPQTVNEDT
CVEELVTSSSSCKNKNAAIRLSTSNCNNSEVGPHAFSTASGKIVCVSHETIKKVKEKFTD
SCSKVIKENTENKSNNCQTKILAGCYKALNESEDIFHNSSGNDECSMHSHKVFADIQSEE
ILQHNQKMFGVEKVSEIPPCDVSLETSGIYKFSMGKLPKSVLSTNTCGIFSTASGKSVQV
SNASLQKARQVFSEIDDSTKQLSSEVLFTNNEHSDQLTREENTATQIAEHLIPSQKGFSY
NVNSSAFSGFNTASGKQVSISESALHKVKGMLEEFDLIRTEHSLHHSPISRQNVSKILPC
VVKRNPEHCVNSEMEKTCSKEFKLSNNFNIEGGSSEHNQSIKVSPYLSQLKQDKQQLVLG
TKVSLVENIDVLGKEQASLENIKMEIGKTETFSDVSVKTNTEVCSTYSKDSENCFETEAV
EIAKAFMEDDELIDSELPSHASHTLITCPKNDEMVLSNSRIGKRRGEAIISVGEPPIKRS
LLNEFDRIIENQEKSLKASKSTPDGTIKDRRLFTHHVSLEPITCVPFCTTKERQKIQNLN
FTAPGQESLSKSHLYEHLTLEKSSSSLAVSGQPFYQVPATRHEKMRRLIATGKPTKVFVP
PFKTKSHLHRDEQCVRNINLEENKPKQNIDGHGSGGGKNKINDSEIHQLNKNNSNQAATV
IFTKREEEPLDLITSLQNARDIQDMRIKKKQRQCIFPQPGSLYLTKTSTLPRISLKAAVG
SQFPSACSHKQLYMYGVSKHYVKINSKNAESFQFHTQDYFGKESLWAGKGIQLADGGWLI
PSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMEFAFPKEFANRCLS
PERVLLQLKYRYDMEIDKSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKT
SSADTQNVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACTPL
EAPESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPI
QWMEKTSSGLYIFRNEREEEKEAAKHAEAQQKRLEALFTKIQEEFEEHEENKTKPYLPSR
ALTRQQVHALQDGAELYEAVKNAADPAYIEGYFSEEQLRALNNHRQMLNDKKQAQIQLEI
RKAMESAEQKEQGLSRNVTTVWKLRIVSYSKKAKDSVILSIWRPSSDLYSLLTEGMRYRI
YHLATSKSKSKSERANIQLVATKKTQYQQLPASDEILFQVYQPRESLHFSKFLDPDFQPS
CSEVDLIGFVVSVVKKTGLAPLVYLSDECHNLLAIKFWIDLNEDIIKPHMLIAASNLQWR
PESKSGLPTLFAGDFSVFSASPKQGHFQETFNNLKNTVENIDIFCNEAENKLMHILQAND
PKWSTPTKDYNSEPHTAQIILPAGNKLLMSSPNCDINYQSPLSLRMPKSKSVSTPVPAQM
TSKSCKGEKEIDDQKSCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSCGTKY
ETPIKKKELNSPQVTPFKKFNEISLLESNSIADEELALINTQALLSGSIGEKQFISVSEF
TRTAPTSSKDCLRLKRCSTTSLIKEQESSRAGTEECENDMQDTSTTEK
NT seq 10227 nt NT seq  +upstreamnt  +downstreamnt
atgcctattggatccaaagagaggcctactttttttgaaatttttaagacacgctgcaac
aaagcagatataggaccaataagccttaattggtttgaagaactttcttcagaagcttca
ccctgtaattctgaacctacagaagaatctgaacataaaatcagcgtttatgaaccaaac
atatttaaaactccacaaaggaaaccctcttataatcaactggcttcaactccaataata
ttcaaagagcaagggctgactctgccaccgtatcaatctcctgtaaaagaattagataaa
ttcagattagacttaggaaggaaggttcccaatggtagacataaaagtcctcgcacagtg
aaagctaaaatggatcaaacagatgatgttacctgtccacttctaaattcttgtctcagt
gaaagtcctgttctgcaatgtacacatgtaacaccacaaagagataagtcagtagtatgt
gggagtttgtttcacacaccaaagtttgtgaagggtcatcagacaccaaaacatatttct
gaaagtctaggagctgaggtggatcctgatatgtcttggtcaagttcgttagccacacca
ccctcccttagttctactgtgctcatagtcagaaatgaggaagcatctgaaactgtattt
cctcatgatactactgctattgtgaaatgctgtttttctaaccatgatgaaagtctgaag
aaaaacagtagatttatcccatctgtgacagacagtgaaaacacaaatcaaagagaagct
acatgtcatggatttggaaaaacattagggaattcatttggtaaagtaaatagctgtaaa
gactacattggaaagtcaatgccaaatgtcctagaagatgaagtatatgaaacaattgta
gatacttccgaagaagatagtttttcattatgtttttctaaatgtagaaaaagaaattta
caaaaagtaagaactgagaagactaggaaaaaaatctatgaagcaaacactgatgaatgt
gaaaaatctaaaagccaagtgaaagaaaagtactcctttgtatctgagctagaaccaaat
gatactgatccattagattcaaatgtagcaaatcagaagctctttgagagtgcaagtgac
aaaatctccaaggaagttgtaccatctttggcctatgaaaggtctcaactaaccctttcc
ggtctacatggaacccagatggagataatacccctattacatatttcttcttgtgaccaa
agtaattcagaaaaaaacctattagatgcagagaatgaaagaaagaaagattttcttact
tcagagaattctttgtcagatatttccagtctcccaaaatcagagaagccattaaatgag
gagagaatggtaaataagaaagatgaagagcagcatcttgaatctgatggagaccacatt
cttgcagtaaagcaggcaacatctggaaatcctctggtggcttcctcttttcagggtatc
aaaaagtccatattcagaataagagaatcgcctaaagagactttgagtgcaagtttttct
ggtagtatgagtgatccaaacgttaaaaaagaaactgaagcctctgaaagtagactagaa
atacatactgtttgctcatggaaggaggataccttatgtccagattcaattgataatgga
agctggccagcctctatcacacagacttctgtagttttgaagaatgcaggtctaatatcc
actttgaaaaagaaaacaaataagtttatttatgctatacatgatgaaacatcttatcaa
ggaaaaaaaatacagaaagaccaaaaatcagaagtaattaactcttcatcccaatttgaa
gcaaatgcttttgaagcaccacttacatttgcaaatactgattcaggtttattgcatcct
tctgtccaaagaaactgttcacagattgattctggagaaccaactttgtccttaaccagc
tcttctgggacaattctgaggaaatgtactagaaatgaaacatgttgtaataatataata
atctctcaggatcttgattataaagaagcaaaatgtaataaggaaaaaacgcagttattt
attaccccagaagctgattctctgtcatgcctgcaggaaggacagtgtaaaaattatcca
aaaagcaaagaagtttctgatataaaagaagaggtcttggccacagcatgtcacctggca
caacattcagaagtggaatattgtgatactgactttcagtcccagaaaactattttacat
gaccatgaaaatgccagctctcttattttaactcctgctttcaaggatgtactgtcaggc
aaagaatcatacagaatttcagacgagctcaaatgtaacaattgtgaagccgattttgag
ttaatcaaaaatatttccatggaaaataatcaagatgtacacgccttaaatgaaaattct
aaaaacattgagctgttgccacccgaaaaatacataatagtagcatcaccttcaagatac
gtacagttcaaccaaaacacaaatctaagagtaatccaaaaagatcaagaagaaactact
ttaatttcaaaaatgactgtcagtccagactctgaagaacttttatcagacaatgagaat
aattttgtcttccaagtagctagtgaaaggaataattttgctttagaaagtactgaggaa
cttcatgaagcagacttgacttgtgtaaacaaacccaattttgagaactctaccatggta
ttacatgcagacatagttgataaacaagcaacccaagtgtcaattaaaaaagatttagac
tcatcaaataaagtttattatcttgcagaggagaaaaaaaatagtgtaaagcagcatcta
gaaatgactctaggtcaagatataaaatcagacatctccttgaatatagataaaatacca
aacaaaaataatgattacaaggacaaatgggcaggactcttacatccaatttcaaatcac
agttttggaggtagcttcagaacagcttcaaataaggaaatcaagctctctgaacataac
attaagaaaagcaaaatgctcttcagagatatcgaagaacaatatcctactagttcagct
tgtgttgaaatagtaaataccttggcattagataatcaaaagaaactaagcaagcctcag
tcaattaagactgtatctgcacatgtacagagtagtgtagttggttttgattgtaaaaat
agtcttacaacccctcagatgttattttcaaaggaagattttaattcaaatcataactta
acacctagccaaaaggcagaaattacagaactttctactatattagaagaatcaggaagt
cagtttgaatttacacagtatagaaaaccaagctacatattgcagaataatatgtttgaa
gtacctgaaaaccagatgactatcttaaatagcacttctgaagaatacagagatgctgat
cttcatctcgtaatgaacgcgccatctattggtcaggtagacagcaggaagcaatttgaa
ggtacagttggaattaaacaaaagtttgctgttttgttgaaaaatgactgtaacaaaagt
gcgtctggttatttaacagatgcagatgaagtggagttgagaggcttttattctgctcat
ggcgtaaaactgaatgtttctactgaagctctgcaaaaagctgtgaaactgtttagtgat
attgagagtattagtgaggaaacttctgcagcagtagatccaataagtttatcttcaagt
aaatgtcatgattctgttgtttcagtgtttaagatagaaaatcatgatgagaaaaataat
gaatgccaactaatattacaaaataatattgaaatgactactggcacttttgttgaagaa
attactgaaaattacaagaaaaatattgaaaatgaagataaacatactgctaccagtaga
aatactcataacttagaatttgatggcagtgattctagtaaaaatgatactgttcatatt
cataaagatgaaaatgacttgccacttactaatcagcacaacatatatcttaaattatct
ggccagtttatgaaggagggaaacactcagattaaagaagatttgtcagatttaactttt
ttggaagttgtaaaagctcaagaaacatgtcatggtaatacttcaaataaagaacagtta
actgctactaaaatggagcaaaatataaaagacgttgggacttttgatctgtcttttcag
acagcaagtgggaaaaatattagtatctccaaagagtcatttaataaagttgtaaatttc
tttgatcagaaaccagaagaactgcataacttttccttaaattctaaattacattctgac
ataagaaagaacaaaatggacattctaagttatgaggaaacagacatagttaaaaacaaa
acactgaaagaaagtatcccagttggcactggaaatcaactagtgaccatccaggaacaa
cccaaaagtaatatcaaaaagatcaaagaacctaccctgttgggttttcacacagctagt
gggaaaaaagttaaaattgcaaaggaatctttggacaaagtgaaaaacctttttgatgaa
aaagggcaagatactggtgaaatcaccagttttagccatcaaggggcaaagaccctaaag
tacagagaggcctataaagaccttgaattagtgcgtgagacagttgagatagcaactact
cgaaagcatgaagaaatgcagaattctctcagtaatgataaaaatcttgtttctattgag
actgtggtgccacctaagcccttaagtgataatttatatagacatactgaaagtctcaaa
acatctgaaggtaactttttgaaagttaaagaacatgaaaatgtagaaaaagaaacagca
gaaagtcctgcaacttgttacagaaatcagtccccttactcggtcattgaaaattcagcc
ttagctttttacacatattgtagtagaaaaacttctgtgagtcaggcttcatcacttgaa
gcaaaacaatggcttagagaaggagaatttgatgatcaaccagaaaatataaatactgta
gattttgtaggaaattctttgtatgaaaataattcaaacaatactataactgaaggtaac
aaaaatcatctctccgaaaaacaagatacttatttaagtaacagtagcatgtctaacagc
tattcctaccattctgatgaggtatataatgattcaggatatcgctcaaaaaataatctt
gattctggtattgagccagtagtgaagaatgttgaagaccagaaaaacactcgttcttcc
aaagtaacattcaatgtgaaagatgcaaatgcatacccacaaactgtaaatgaagatact
tgtgttgaggaacttgtgactagctcatcatcctgcaaaaataaaaatgcagccattaga
ttgtccacgtctaactgtaataattctgaggtagggccacatgcatttagtacagccagt
ggcaaaatagtttgtgtttcacatgaaacaattaaaaaagtgaaagagaaatttacagac
agttgcagtaaagtaattaaggaaaacactgagaataaatcaaataattgccaaacaaaa
attctggcaggttgttacaaggcattaaatgaatcagaggatatttttcataattcttca
ggtaatgatgaatgtagcatgcattcacataaagtttttgctgacattcaaagtgaagaa
attttacaacataaccaaaaaatgtttggagtggagaaagtttctgaaataccaccttgt
gatgttagtttggaaacttcaggtatatataaatttagtatggggaagcttcctaagtca
gtcttgtctacaaatacttgtgggatttttagcacagcaagtggaaaatctgtacaggta
tcaaatgcttcattgcaaaaggcaagacaagtgttttctgagatagatgatagtaccaag
caactctcttccgaagtattgtttacaaataatgaacattcagaccagctcacaagagaa
gaaaatactgctacacagatagcagaacatttgataccatcccaaaaaggcttttcatat
aatgtaaattcatctgctttttctggatttaatacagcaagtggaaagcaagtttccatt
tcagaaagtgccttgcacaaagttaagggaatgttagaggaatttgatttaatcagaact
gagcatagtcttcaccattcacctatatctagacaaaatgtatcaaaaatacttccttgt
gttgttaagagaaacccagagcactgtgtaaactcagaaatggagaaaacctgcagtaaa
gaatttaaattatcaaataactttaatattgaaggtggttcttcagaacataatcagtct
attaaagtttctccatatctctctcagcttaaacaagacaaacaacagttggtattaggc
accaaagtctcacttgttgaaaacattgatgttttgggaaaagaacaggcttcacttgaa
aacataaaaatggaaattggtaaaactgaaactttctctgatgtttctgtgaaaacaaat
acagaagtttgttctacttactccaaagactcagaaaactgctttgaaacagaagcagta
gagattgctaaagcttttatggaagatgatgaactgatagattctgaactgccaagtcat
gcctcacacactcttattacatgtcccaaaaatgacgaaatggttttgtcaaattcaaga
attggaaaaagaagaggagaggccattatctcagtgggagaacccccaatcaaaagaagc
ttgttaaatgaatttgacaggataatagaaaatcaagaaaaatccttaaaggcttcaaaa
agcactccagatggcacaataaaagatagaagattgtttacgcatcacgtttctttagag
ccgattacctgtgtacccttttgcacaactaaggaacgtcaaaagatacagaatctaaat
tttactgcacctggtcaagaatctctgtctaaatctcatttgtatgaacatctgactttg
gaaaaatcttcaagcagtttagcagtttcagggcaaccattttatcaagttcctgctaca
agacatgaaaaaatgagacgcttgattgctacaggcaaaccaaccaaagtctttgttcca
cctttcaaaactaaatcacatcttcacagagatgaacagtgtgttaggaatattaacttg
gaggaaaacaaaccaaaacaaaacattgatggtcatggctccggtggtggtaaaaataag
attaacgacagtgagattcatcagttgaacaaaaacaactccaatcaagcagcaactgta
attttcacaaaacgtgaagaagaacctttagatttaattacaagtcttcagaatgccaga
gatatacaggatatgcgaattaagaagaaacaaaggcagtgcatctttccacaaccaggc
agtctgtatcttacaaaaacatccactctgcctcgaatctctctgaaagcagcagtagga
agccaatttccctctgcatgttctcataaacagctatatatgtatggcgtttctaaacat
tatgtaaaaattaacagcaaaaatgcagagtcttttcagtttcacactcaagattatttt
ggtaaggaaagtttatgggctggaaagggaatacagttggctgatggtggctggctcata
ccctccaatgatggaaaggctggaaaagaagaattttatagggctctgtgtgacactcca
ggtgtggatccaaagcttatttctagaatttgggtttataatcactacagatggatcata
tggaaactggcagctatggaatttgcctttcctaaggagtttgctaatagatgcctaagc
ccagaaagggtgcttcttcaactaaaatacagatatgatatggaaattgataaaagcaga
agatcggctataaaaaagatcatggaaagggatgacacagctgcaaaaacacttgttctc
tgtgtttctgacataatttcattgagcgcaaatatatctgaaacatctagcaataaaact
agtagtgcagatacccaaaacgtggccattattgaacttacagatgggtggtatgctgtt
aaggcccagttagatcctcccctcttagctgtcttaaagaacggcagactgacagttggt
cagaagattattcttcatggagcagaactggtgggctctcctgatgcctgtacacctctt
gaagccccagaatctcttatgttaaagatatctgctaacagtactcggcctgctcgctgg
tataccaaacttggattctttcctgaccctagaccttttcctctgcccttatcatcactt
ttcagtgatggaggaaatgttggttgtgttgatgtaattattcaaagagcataccctata
cagtggatggagaagacatcatctggattatacatatttcgcaatgaaagagaggaagaa
aaggaagcagcaaaacatgcggaggcccaacaaaagagactagaagccttattcactaaa
attcaagaggaatttgaagaacatgaagaaaacaaaacaaaaccatatttaccatcacgt
gcactaacaagacagcaagttcatgctctgcaagatggtgcagagctctatgaagcagtg
aagaatgcagcagacccagcttacattgagggttatttcagtgaagagcagttaagagcc
ttgaataatcacaggcaaatgttgaatgataagaaacaagctcagatccagttggaaatc
aggaaagccatggaatctgctgagcaaaaagaacaaggtttatcaaggaatgtcacaact
gtgtggaagttgcgtattgtaagctattcaaaaaaagcgaaagattcagttatattgagt
atttggcgtccatcatcagatttatattctctgttaactgaaggaatgagatatagaatc
tatcatcttgcaacttcaaaatctaaaagtaaatctgaaagagccaacatacagttagtg
gcgacaaaaaaaactcagtatcaacaactaccggcttcagatgaaattttatttcaggtt
taccaaccacgggaatcccttcacttcagcaaatttctagatccagactttcagccatct
tgttctgaggtggacctaataggatttgtagtttctgttgtgaaaaaaacaggacttgct
cctttggtctatttgtcagacgaatgtcataatttattggcaataaaattttggatagat
cttaatgaagacattattaaacctcatatgttaatcgctgcaagcaacctccagtggcga
ccagaatccaaatcaggacttcctactttatttgctggtgatttttctgtgttttctgct
agtccaaaacaaggccactttcaagagacattcaacaatttgaaaaatactgttgagaat
attgacatattttgcaatgaagcagaaaacaagcttatgcatatactacaagcaaatgat
cccaagtggtccaccccaactaaagactataattcagagccacacactgctcaaatcatt
cttcctgcaggaaataagcttctgatgtcttctcctaattgtgatataaattatcaaagt
ccgttatcacttcgtatgcccaaaagtaagtctgtttccacacctgtaccagcccaaatg
acttcaaagtcttgtaaaggggagaaagagattgatgaccaaaaaagctgcaaaaagaga
agagccttggatttcttgagtagactgcctttacctccacctgttagtcccatttgtaca
tttgtttctccagctgcacagaaggcatttcaaccaccaaggagttgtggcaccaaatac
gaaacacctataaagaaaaaagaattgaattctccacaggtgactccatttaaaaaattc
aatgaaatttctcttttggaaagtaattcaatagctgacgaagaacttgcattaataaat
acccaagctcttttgtctggttcaataggagaaaaacaatttatatctgtcagtgaattc
actaggactgctcccaccagttcaaaagattgtctcagactgaaaagatgttctactaca
tctctgatcaaagaacaggagagttcccgggccggtacagaagaatgtgagaatgatatg
caggacacaagtacaactgaaaaataa

DBGET integrated database retrieval system