KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397620Help
Entry
100397620         CDS       T03264                                 

Gene name
TOP3A
Definition
(RefSeq) topoisomerase (DNA) III alpha
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00414  Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100397620 (TOP3A)
   03460 Fanconi anemia pathway
    100397620 (TOP3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100397620 (TOP3A)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100397620 (TOP3A)
Enzymes [BR:cjc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     100397620 (TOP3A)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Topoisomerases
   100397620 (TOP3A)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     100397620 (TOP3A)
   FA (Fanconi anemia) pathway
     100397620 (TOP3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_bac zf-GRF Toprim zf-C4_Topoisom zf-C2H2_10
Motif
Other DBs
NCBI-GeneID: 100397620
NCBI-ProteinID: XP_008994684
Ensembl: ENSCJAG00000001058
UniProt: F7BHS6
Position
5
AA seq 1001 aa AA seqDB search
MIFPVARYALRCLRRPGGRAFSRAAMEVALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLERETHQCQALVIWTDCDREGENIGFEIIHVCKAVKPSLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQKIFPEVLSEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFSWKRHRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNSLQGNEQRLYEFIVRHFLACCSQDAQGQETTVEIDISQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGFRFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKK
DKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTEVAQQEDIYPAMPEPIRKCPQ
CNKDMVLKTKKNGGLYLSCTGFPECRSAIWFPDSVLEASRDGSVCPVCQPHPVYRLKLKF
KRGSLPPTMPLEFVCCIGGCDETLREILDLRFSQGPPRASQPSGRLQASQYLNRMDSSHH
PQPADGRQTGPSKALAWTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNQGRQFFKCNT
GSCNFFLWADSPNLGAGGLPTSAYRPLGGSLGCPPGPGTHLGGFGNPGVGSGNGTSCLCS
QPTVKRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENMAPGTSGALPWKRGGGGTLGL
EARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcctgtcgctcgctacgcgctccggtgtctgagacggcccggaggccgtgcc
ttttcccgcgccgccatggaggtggccctccgaggggtgcggaaagtcctctgtgtggcc
gagaaaaacgacgcggccaaggggattgccgacctgctgtccaacggtcgcatgaggcgg
agagaaggactttcaaaattcaacaagatctatgaatttgattatcacctatacggccag
aacgttaccatggtaatgacttcagtttctggacatttactggctcatgatttccagatg
cagtttcgaaaatggcagagctgcaaccctcttgtcctctttgaagcagaaattgaaaag
tattgcccagagaattttgttgacatcaagaaaactctggagcgagagactcaccagtgt
caggctttggtgatctggactgactgtgatagagaaggtgaaaacattggctttgagatt
atccacgtatgtaaggctgtaaagcccagtctgcaggtgttgcgagcccgattctctgag
attacaccccatgctgtcaggacagcctgtgaaaacctgaccgagcctgatcagagggtg
agcgatgctgtggatgtgaggcaggagctggacctgaggatcggagctgcctttactagg
ttccagaccctgcggcttcagaagatttttcctgaggtgctgtcagagcagcttatcagt
tatggcagctgccagttccccacacttggctttgtggtggagcggttcaaagccattcag
gcttttgtaccagaaatcttccacagaattaaagtaactcatgaccacaaagatggtatc
gtagaattcagctggaaaaggcatcgactctttaaccacacggcgtgcctagttctctat
cagttgtgtatggaggatcccatggcaactgtagtagaggtcagatccaagcccaagagc
aagtggcggcctcaagctttggacactgtggagcttgagaaactggcttctcgaaagttg
agaataaatgctaaagaaaccatgaggattgctgagaagctctacactcaagggtacatc
agctatccccgaacagaaacaaacatttttcccagagacttaaacctgacggtgttggtg
gaacagcagacccctgatccacggtggggggcctttgcccagagcattctagagcggggt
ggtcccaccccacgcaatgggaacaagtctgaccaagctcaccctcccattcacccaacc
aaatacaccaatagcttacagggaaacgaacagcgactgtatgagtttattgttcgccat
ttcctggcttgctgctcccaggacgctcaggggcaggagaccacagtggagatcgacatc
tctcaggaacgctttgtggcccatggactcatgattctggcccgaaactatctggacgtg
tatccatatgatcactggagtgacaagatcctccctgtctacgagcaaggcttccgcttt
cagcccagcactgtggagatggtggatggggagaccagcccgcccaagctgctcaccgag
gccgacctcattgccctcatggagaagcacggcattggtacggatgccactcacgcagag
catatcgagaccatcaaagcccggatgtacgtggggctcaccccagacaagcggttcctc
cctgggcacctgggcatgggacttgtggaaggctatgattccatgggctatgagatgtct
aagcctgacctccgggctgaactggaagctgatctgaagctgatctgtgagggcaagaag
gacaaatttgtggttctaaggcagcaagtgcaaaaatacaagcaggttttcattgaagca
gtggctaaagcaaagaaattggacgaggccttggcccagtactttgggaatgggacagag
gtggcccagcaagaagacatctacccagccatgccagagcctatcaggaagtgcccacag
tgcaacaaggacatggtcctcaaaaccaagaagaacggcgggctctacctcagctgcacg
ggtttcccagagtgtcgctcagccatatggtttcctgactcggtgctggaggccagcagg
gatggcagtgtgtgtccagtttgtcagccacaccctgtgtacaggttgaagttaaagttt
aagcgtggtagccttcccccgaccatgcccctggagtttgtttgctgcatcggaggatgt
gacgagaccctgagggagatcctggacctgagattttcacagggccccccaagggctagc
cagccctctggccgcctgcaggccagccagtacctgaacaggatggacagcagccaccac
ccccagcctgctgacggcagacagactgggccctcaaaggctctggcctggaccctccca
ccacccacggctgctggtgaaagcaactcggtgacctgcaactgtggccaggaggctgtg
ctgctcactgtccgtaaggagggtcccaaccaaggccggcaattctttaagtgcaacacg
ggtagctgcaacttcttcctatgggcagatagccccaatttgggagcaggaggactgccc
acctcagcatatagacccctaggtggctccctgggatgcccaccaggcccagggacccac
ctgggtgggtttggcaaccctggtgttggcagtggtaatggcacatcctgcctgtgtagc
cagcccaccgtcaaacggactgtgcagaaggatgggcccaataaggggcgccagttccac
acatgtgccaagccgagagaacagcagtgcggcttcttccagtgggtcgatgagaacatg
gctccagggacttctggagccctgccctggaaaagaggcggaggaggaaccctagggttg
gaggccagaagcaaaaggccccgggccagttcctcagacatgggatccacagcaaagaaa
ccccggaaatgcagcctttgccaccagcctggacacacccgtcccttttgtcctcagaac
agatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401442Help
Entry
100401442         CDS       T03264                                 

Gene name
TOP3B
Definition
(RefSeq) topoisomerase (DNA) III beta
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Module
cjc_M00414  Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100401442 (TOP3B)
   03460 Fanconi anemia pathway
    100401442 (TOP3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cjc03032]
    100401442 (TOP3B)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100401442 (TOP3B)
Enzymes [BR:cjc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     100401442 (TOP3B)
DNA replication proteins [BR:cjc03032]
 Eukaryotic Type
  DNA Topoisomerases
   100401442 (TOP3B)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     100401442 (TOP3B)
   FA (Fanconi anemia) pathway
     100401442 (TOP3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_bac Toprim
Motif
Other DBs
NCBI-GeneID: 100401442
NCBI-ProteinID: XP_002743624
Ensembl: ENSCJAG00000020334
UniProt: F7ADD1
Position
1
AA seq 862 aa AA seqDB search
MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGH
VMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDK
EGENICFEVLDAVLPVMNKAHGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDA
RQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETY
WVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTKLEKEAQVEATSRKEKAKQRPLA
LNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPRTETTHYPENFDLKGALRQQANH
PYWADMVKRLLAEGINRPRKGHDAGDHPPITPMRSATEAELGGDAWRLYEYITRHFIATV
SHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEIMPWQSVPLEESLPTCQRGDTFTVSE
VKMLEKQTSPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNL
GIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSI
AGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYTLPQNGTIKL
YKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSM
LGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCFENAHRVRVSADTCSVCEAALLD
VDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAASCHPMHRSGPGRRQGRGRGRARR
PPGKPNPRRPKDKMSALAAYFV
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtgctcatggttgctgaaaagccatccttggcgcagtcaattgccaaaatc
ctctctagagggagcctgtcctcacacaaagggctgaatggagcctgctcagtccatgag
tacactgggacctttgctggccagccagtgcgcttcaagatgacatctgtctgtggtcac
gtgatgaccctggatttcctgggaaaatacaacaagtgggacaaagtagaccccgcagag
ctgttcagccaagctcccacggaaaagaaagaagctaaccccaagctgaacatggtgaag
ttcctgcaggtggagggcagaggctgcgactatattgtgctgtggctggactgcgacaag
gagggggagaacatctgctttgaggttcttgatgctgttctgcccgtcatgaacaaggct
catggcggcgagaagactgtgttccgggccaggtttagctccatcacggacacagacatc
tgtaatgccatggcctgcctgggcgagcctgaccacaacgaggcactctcagtggatgct
cgccaggagctggacctgcgcatcggctgtgcattcaccaggtttcaaactaaatatttc
caggggaaatacggtgatttagacagctctctcatctcctttgggccatgtcagactcca
accctgggattctgcgtggagagacatgataaaatccagtccttcaaaccagagacctac
tgggtgctgcaggccaaggttaacactgacaaagacagatctctccttttggactgggac
cgagtaagagtgttcgaccgggagattgcacagatgtttttaaacatgacaaagctggag
aaggaagcccaggtggaggccacaagcaggaaagaaaaggccaagcagaggcctctggcc
ctgaacactgtggagatgttgcgtgtagccagctcttctctgggcatgggaccacagcac
gccatgcagacagccgagcggctctacacacaaggctacatcagctacccacgtacagag
accacccactaccctgagaactttgacctgaagggtgctctgcggcagcaggccaaccac
ccctactgggctgacatggtaaagcggttgttagcagaaggtatcaaccgcccacggaaa
ggccacgatgccggcgaccatccccccatcacccccatgaggtctgccacagaagctgaa
ttagggggtgacgcatggcggctctacgaatacatcaccagacatttcatcgccacagtc
agccatgactgcaagtacctgcagagcaccatctccttcaggattgggccagagctcttc
acctgctccgggaagaccgtcctctcaccaggcttcacggagattatgccctggcagagc
gtgcccctggaggagagcctgcccacctgccagcggggtgacaccttcactgtgagtgag
gtaaagatgctggagaagcagacgagcccacccgactacctgacggaggctgagctcatc
acgctcatggagaagcacggcatcggcacagatgccagcatccctgtgcatatcaacaac
atctgccagcgcaactatgtcaccgtggagagcgggcgccggctcaaacccaccaacctc
ggcattgtcctggtgcacggctactacaagattgatgcagagctagtgctccccaccatc
cgaagtgcagtggagaagcagctgaacctgatcgcccagggcaaggccgactaccgccag
gtcctgggccacaccctggacgtgttcaagaggaagttccactactttgtcgactccatt
gcaggcatggatgagttaatggaggtgtctttctcacccctggcggccacaggcaagccc
ctgtcacgctgcgggaagtgccaccgcttcatgaagtacatccaggccaagccaagccgc
ctgcactgctcccactgtgacgagacttacacactcccccaaaatggcaccatcaagctc
tacaaggagctccgctgccctctggacgactttgagctggtcctgtggtcatcaggctct
cggggcaagagctacccactgtgcccctactgctacaaccacccacccttccgagacatg
aagaaaggcatgggctgcaatgaatgtacacacccctcctgccagcactcgctgagcatg
ctgggcatcggccagtgcgtggaatgcgagagtggggtactggtgctggaccccacctcg
ggccccaagtggaaggtagcctgcaacaagtgcaacgtggtggcgcactgctttgagaac
gcccaccgtgtgcgggtgtccgccgacacctgcagtgtctgtgaggccgccttgcttgac
gtggacttcaacaaggccaagtccccactcccaggtgatgagacacagcacatgggctgc
gtcttctgtgaccccgtcttccaggagctggtggagctgaagcatgcagcctcctgccac
cccatgcaccgcagtggaccagggaggagacagggtcgagggcggggccgggccaggagg
ccccctgggaagcccaaccccaggcggcccaaggacaagatgtcagccctggccgcctac
ttcgtatga

DBGET integrated database retrieval system