KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397803Help
Entry
100397803         CDS       T03264                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04115  p53 signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04650  Natural killer cell mediated cytotoxicity
cjc04668  TNF signaling pathway
cjc04932  Non-alcoholic fatty liver disease (NAFLD)
cjc04940  Type I diabetes mellitus
cjc05010  Alzheimer disease
cjc05142  Chagas disease (American trypanosomiasis)
cjc05143  African trypanosomiasis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05320  Autoimmune thyroid disease
cjc05330  Allograft rejection
cjc05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100397803 (FAS)
   04668 TNF signaling pathway
    100397803 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397803 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100397803 (FAS)
   04217 Necroptosis
    100397803 (FAS)
   04115 p53 signaling pathway
    100397803 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100397803 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397803 (FAS)
   05205 Proteoglycans in cancer
    100397803 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100397803 (FAS)
   05330 Allograft rejection
    100397803 (FAS)
   05332 Graft-versus-host disease
    100397803 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100397803 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100397803 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100397803 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100397803 (FAS)
   05162 Measles
    100397803 (FAS)
   05164 Influenza A
    100397803 (FAS)
   05161 Hepatitis B
    100397803 (FAS)
   05160 Hepatitis C
    100397803 (FAS)
   05168 Herpes simplex virus 1 infection
    100397803 (FAS)
   05163 Human cytomegalovirus infection
    100397803 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397803 (FAS)
   05169 Epstein-Barr virus infection
    100397803 (FAS)
   05165 Human papillomavirus infection
    100397803 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100397803 (FAS)
   05143 African trypanosomiasis
    100397803 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100397803 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:cjc04050]
    100397803 (FAS)
   04090 CD molecules [BR:cjc04090]
    100397803 (FAS)
Cytokine receptors [BR:cjc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100397803 (FAS)
CD molecules [BR:cjc04090]
 Proteins
  100397803 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TNFR_c6 Stn1_C
Motif
Other DBs
NCBI-GeneID: 100397803
NCBI-ProteinID: NP_001254702
Ensembl: ENSCJAG00000005615
UniProt: A8WEX9
Position
12
AA seq 326 aa AA seqDB search
MLGIWTLLTLVLKLFGLLSKSVNAQVTDINPKGLELRKTVTAVETQNLEDQYYVDQFCRK
PCGPGEKKARECTVDGDEPDCVPCQEGREYADKSHFSSKCRRCRLCDEGRGLEVEINCTR
TQNTKCRCKPNFFCNSAVCEHCDPCTTCEHGIIKECTLTSNAKCQEEGFRSDLLWLCLLF
LILPVVWGVIRYIKHRRANQGHRESTTLNSETVPINLPDVDLSKYITVIAEHMTISQVRD
FVRKNGVNEAKIDEIKNDNIKDTAEQRVQLLRNWYQLHGKKDAYDTLIKGLKKANLTALA
EKIQNIIIKDSESSNFTNQNENQSMV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctaactctggttcttaaattatttggattattgtctaaa
agtgttaatgctcaagtgactgatatcaaccccaaggggctggaattgaggaagactgtt
actgccgttgagactcagaacttggaagaccagtattacgtggaccaattctgccgtaag
ccctgtggtccaggcgaaaagaaagctagggagtgtacagtggatggggatgaaccagac
tgcgtgccctgccaagaagggagggaatacgcagacaaaagtcatttttcttccaaatgc
agaagatgtagattgtgtgacgaaggacgtggcttagaagtggaaatcaactgtacccgg
acccagaataccaagtgcagatgtaaaccaaactttttttgtaattctgctgtatgtgaa
cactgtgacccttgcaccacatgtgaacatggaatcatcaaggaatgcacactaaccagc
aatgctaagtgtcaagaggaaggattcagatctgacttgctgtggttgtgtctccttttc
ctaattctaccagttgtttggggggtgataagatacataaagcacagaagggcaaaccaa
ggtcatcgtgaatctacaaccttaaattctgaaacggtgccaattaatttacctgatgtt
gacttgagtaaatatatcaccgttattgctgaacacatgacaataagtcaagttagagac
tttgttcggaagaatggcgtcaatgaagccaaaatagatgagatcaagaatgacaatatc
aaagacacagcggaacagagagttcagctgcttcgtaattggtatcaacttcatgggaag
aaagatgcatatgacactttgattaaaggtctcaaaaaagccaatcttactgctcttgca
gagaaaattcagaatatcatcatcaaggactcagaaagttcaaacttcacaaatcaaaat
gaaaaccaaagcatggtctag

DBGET integrated database retrieval system