KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397816Help
Entry
100397816         CDS       T03264                                 

Gene name
CCL21
Definition
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100397816 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397816 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100397816 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397816 (CCL21)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100397816 (CCL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100397816
NCBI-ProteinID: XP_002743088
Ensembl: ENSCJAG00000008940
UniProt: F7B701
Position
1
AA seq 134 aa AA seqDB search
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLRYSLRKIPAKVVRGYRKQEPSLGCSIP
AILFLPRKRSQPELCADPKEPWVQQLMQHLDKTPAPRKPPQNCRKDRGAPKTGKKGKGSK
GCKRTEQSQTPKGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcgctagctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgctgcctcaggtacagcctaaggaagatt
cccgccaaggttgtccgtggctaccgaaaacaggaaccaagcttaggctgctccatccca
gctatcctattcttgccccgcaagcgctctcagccagagctatgtgcagacccgaaggag
ccctgggtgcagcagctgatgcagcatctggacaagacaccagccccacggaaaccaccc
cagaactgcaggaaggacaggggggcccccaagactggcaagaagggaaagggctccaaa
ggctgcaagaggactgagcagtcacagacccctaaagggccatag

DBGET integrated database retrieval system