KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397848Help
Entry
100397848         CDS       T03264                                 

Gene name
LTB, TNLG1C
Definition
(RefSeq) lymphotoxin beta
  KO
K03157  lymphotoxin beta (TNF superfamily, member 3)
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04064  NF-kappa B signaling pathway
cjc05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100397848 (LTB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397848 (LTB)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100397848 (LTB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397848 (LTB)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Tumor necrosis fators
   100397848 (LTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 100397848
NCBI-ProteinID: XP_002746384
Ensembl: ENSCJAG00000003102
UniProt: F7I2U6
Position
4
AA seq 244 aa AA seqDB search
MGAMGLEGRGGRLQGKGTLLLAVAGATFLVTLLLVVPITVLAVLALVPQDQGGLVTETAD
PGAQAQQGLGFQKLPEEEPETDLGPELPAAHLIGAPLKGQGLAWEATKEQAFLSSGTQFS
DAEGLALPQDGLYYLYCFVGYRGRAPPGGEGPRGRSVTLRSSLYREGGAYGPGTPELLLE
GAETVTIVLDPAGRQGYGPLWYTSVGFGGLVQLRRGEKVYVNISHPDMVDFARGKTFFGA
VMVG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaatggggctggagggcaggggtgggaggctccaggggaaaggcaccctcctg
ctcgctgtggcaggagccacatttctggtgaccctgttgctggtggtgcctatcactgtc
ctggctgtgctggccttggtgccccaggatcagggaggactggtaacggagaccgctgac
cccggggcacaggcccagcaaggactggggtttcagaagctgccggaggaggagccagaa
acagatctcggccccgagctcccagctgcccacctcataggcgctccgctgaaggggcag
gggctagcctgggaggcgacgaaggaacaggcgtttctgagcagcgggacgcagttctcg
gacgccgaggggctggctctccctcaggacggcctctattacctctactgtttcgtcggc
taccggggccgggcgccccctggcggcgagggtccccggggccgctcggtcacgctgcgc
agctcgctgtaccgggaggggggcgcctacgggccgggcactcccgagctgctgctcgag
ggcgccgagaccgtgaccatcgtgctggacccggccgggaggcaagggtacgggcctctc
tggtacacgagcgtggggttcggaggcctggtgcagctccggaggggcgagaaggtgtac
gtcaacatcagtcaccccgatatggtggacttcgcgagagggaagaccttctttggggct
gtgatggtggggtga

DBGET integrated database retrieval system