KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397928Help
Entry
100397928         CDS       T03264                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04110  Cell cycle
cjc04218  Cellular senescence
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Module
cjc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100397928 (RB1)
   04218 Cellular senescence
    100397928 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397928 (RB1)
   05203 Viral carcinogenesis
    100397928 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100397928 (RB1)
   05225 Hepatocellular carcinoma
    100397928 (RB1)
   05226 Gastric cancer
    100397928 (RB1)
   05214 Glioma
    100397928 (RB1)
   05220 Chronic myeloid leukemia
    100397928 (RB1)
   05218 Melanoma
    100397928 (RB1)
   05219 Bladder cancer
    100397928 (RB1)
   05215 Prostate cancer
    100397928 (RB1)
   05224 Breast cancer
    100397928 (RB1)
   05222 Small cell lung cancer
    100397928 (RB1)
   05223 Non-small cell lung cancer
    100397928 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100397928 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100397928 (RB1)
   05161 Hepatitis B
    100397928 (RB1)
   05160 Hepatitis C
    100397928 (RB1)
   05163 Human cytomegalovirus infection
    100397928 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100397928 (RB1)
   05169 Epstein-Barr virus infection
    100397928 (RB1)
   05165 Human papillomavirus infection
    100397928 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100397928 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100397928 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100397928 (RB1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100397928 (RB1)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    100397928 (RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Motif
Other DBs
NCBI-GeneID: 100397928
NCBI-ProteinID: XP_008990285
Ensembl: ENSCJAG00000009076
UniProt: U3FWB8
Position
1
AA seq 927 aa AA seqDB search
MPPKTPRKAAAAAAAAVEPPAPPPQSSPEEDPEQDSGPEDLPLVRVEFEETEEPDFTALC
QKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMPFTFTELQ
KNIEISVFKFFDLLKEIDTSTKVDNAMSRLLKKYNVLLALFSKLERTCELIYLTQPSSSI
STEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPVLLKEPYKT
AVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMN
SLGLVTSNGLPEVESLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFEAQRTPRKSN
LDEEVNVISPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKD
IGYIFKEKFAEAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNI
FHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGN
LTREMIKHLERCEHRIMESLAWHSDSPLFDLIKQSKDREGPTDHLESACPLNVPLQNNHT
AADMYLSPVRSPKKKGSATRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLR
LNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKF
KIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSP
IPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPGTRILVSIGESFGT
SEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLQGESKFQQKL
AEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaacgccccgaaaagccgccgccgccgccgccgctgccgtggaaccccca
gcgccgccgcctcagtcttctcctgaggaggacccagagcaggacagcggcccggaggac
ctgcctctggtcagggttgagtttgaagaaactgaagaacctgattttacagcgttatgt
cagaaattaaagataccagatcatgtcagagagagagcttggttaacttgggagaaagtt
tcatctgtggatggagtattgggaggttatattcaaaagaaaaaggagctgtggggaatc
tgtatctttattgcagcagttgacctagatgagatgccgttcacttttactgaactacag
aaaaacatagaaatcagtgtctttaaattctttgacttactaaaagaaattgataccagt
accaaagttgataatgctatgtcgagactgttgaagaagtataatgtattgttggcactc
ttcagcaaattagaaaggacatgcgaacttatatatttgacacaacccagcagttcgata
tctactgaaataaattctgcattggtgctaaaagtttcttggatcacatttttattagct
aaaggggaagtattacaaatggaagatgatctggtgatttcatttcagttaatgttatgt
gtccttgactattttattaaactctcacctcctgtgttgctcaaagaaccatataaaaca
gctgttatacccattaatggttcacctcgaacacccaggcgaggtcagaacaggagtgca
cggatagccaaacaactagaaaatgatacgagaattattgaagttctctgtaaagaacac
gaatgtaatatagatgaggtgaaaaatgtttattttaaaaattttataccttttatgaat
tctcttggacttgtaacatctaatggacttccagaggttgaaagtctgtctaaacgatac
gaagaaatttatcttaaaaataaagatctagatgcaagattatttttggatcatgataaa
actcttcagactgattctatagacagttttgaagcacagagaacaccacgaaaaagtaac
cttgatgaagaggtgaatgtgatttctccgcacactccagttaggactgttatgaatact
atccaacaattaatgatgattttaaattcagcaagtgatcagccatcagaaaatctgatt
tcctattttaacaattgcacagttaatccaaaagaaagtatactgaaaagagtgaaggat
attggatacatctttaaagagaaatttgctgaagctgtgggacagggatgtgttgaaatt
ggatcacagcgatacaaacttggagttcgcttgtattaccgagtaatggaatccatgctt
aaatcagaagaagaacgattatccattcaaaattttagcaaacttctaaacgacaacatt
tttcatatgtctttattggcgtgtgctcttgaggttgtaatggccacatatagcagaagc
acatctcagaatcttgattctggaacagatttgtccttcccatggattctgaatgtactt
aatttaaaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaaggcaac
ttgacaagagaaatgataaaacatttagaacgatgtgaacatcgaatcatggaatccctt
gcatggcactcagattcacctttatttgatcttattaaacaatcaaaggaccgagaagga
ccaactgatcaccttgaatctgcttgtcctcttaatgttcctctccagaataatcacact
gcagcagatatgtatctttctcctgtaagatccccaaagaaaaaaggttcagctacacgt
gtaaattctactgcaaatgcagagacacaagcaacctcagccttccagacccagaagcca
ttgaaatctacctctctttcactgttttataaaaaagtgtatcgtctagcatatctccgg
ctaaatacgctgtgtgaacgccttctgtctgagcacccagaactagaacacatcatctgg
acccttttccagcacacgctgcagaatgagtatgaactcatgagagacaggcatttggac
caaattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaattc
aaaatcattgtaacagcatacaaagatcttcctcatgctgttcaggagactttcaaacgt
gttttgatcaaagaagaggagtatgattctattatagtattctataactcagtcttcatg
cagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtcacca
atacctcacattcctcgaagcccttataagtttcctagttcacccttacggattcctgga
gggaacatctatatatcacccctgaagagtccatataaaatttcagaaggtctgccaaca
ccaacaaaaatgactccaggaacaagaatcttagtatcaattggtgaatcatttgggact
tctgagaagttccagaaaataaatcagatggtttgtaatagtgaccgtgtgctcaaaaga
agcgctgaaggaagcaaccctcctaaaccgctgaaaaaactacgctttgatattgaagga
tcagatgaagcagatggaagtaaacacctccaaggggaatccaaatttcagcagaaactg
gcagaaatgacatctactcgaacacggatgcaaaagcagaaaatgaatgacagcatggat
acctcaaacaaggaagaaaaatga

DBGET integrated database retrieval system