KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397966Help
Entry
100397966         CDS       T03264                                 

Gene name
IL34
Definition
(RefSeq) interleukin 34
  KO
K22633  interleukin 34
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100397966 (IL34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100397966 (IL34)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100397966 (IL34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL34
Motif
Other DBs
NCBI-GeneID: 100397966
NCBI-ProteinID: XP_017822259
Position
20
AA seq 280 aa AA seqDB search
MMVTRLWTLWTVWMRCRMLMCPCRMWSTDLGILLSMALGNEHLEMWPLTQSKECTVTGFL
RDKLQYRNRLQYMVTMWAPAVSLSPSAGAHLGQVPGERVVRAQRALVSGVAVTSLSLQQR
ARVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLDVQRGLTDVEVSPKV
ESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEMPSPQSYSPE
PSLQCVATQPYPPPPQPPSCSPHSTGSSRPVRTQSKGLLP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcactcggctttggacgttgtggactgtgtggatgagatgcaggatgctcatg
tgcccttgtcgcatgtggtccacagatcttggcatcctcctcagcatggccttggggaat
gagcatttggagatgtggcccttgacgcagagcaaggagtgcactgtcacgggttttctg
cgggacaaactgcagtacaggaaccgacttcagtacatggtaaccatgtgggcaccagct
gtttccttgtccccaagtgctggggctcacctggggcaagtccctggtgagagggtggtc
cgagcccagagggctctcgtctcgggggttgcagtgacttccctgtctctgcagcagagg
gcccgggtgagcgagcgggagttgcggtatctgtgggtcttggtgagtctcagtgccact
gaatcggtgcaggatgtgctgctcgagggccacccgtcctggaagtatctgcaggaggtg
cagacgctgctgctggatgtccagcggggcctcacggacgtggaggtcagccccaaggtg
gaatccgtgttgtccctcctgaatgccccagggccaaacctgaagctggtgcggcccaaa
gccctgctggacaactgcttccgggtcatggagctgctgtactgctcctgctgtaaacaa
agctctgtcctaaactggcaggactgtgagatgccaagtcctcagtcctatagcccagag
ccctcattgcaatgtgtggccacccagccgtatcctccgcctccacagccccccagctgc
tctcctcattccaccggctcatcgaggccggtcaggacacagagcaagggtctcttgccc
tga

DBGET integrated database retrieval system