KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398059
Entry
100398059         CDS       T03264                                 
Symbol
CCR1
Name
(RefSeq) C-C motif chemokine receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04061  Viral protein interaction with cytokine and cytokine receptor
cjc04062  Chemokine signaling pathway
cjc05163  Human cytomegalovirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100398059 (CCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100398059 (CCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100398059 (CCR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100398059 (CCR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100398059 (CCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100398059 (CCR1)
   04050 Cytokine receptors [BR:cjc04050]
    100398059 (CCR1)
   04090 CD molecules [BR:cjc04090]
    100398059 (CCR1)
G protein-coupled receptors [BR:cjc04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100398059 (CCR1)
Cytokine receptors [BR:cjc04050]
 Chemokine receptors
  CC Chemokine
   100398059 (CCR1)
CD molecules [BR:cjc04090]
 Proteins
  100398059 (CCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100398059
NCBI-ProteinID: NP_001171970
Ensembl: ENSCJAG00000021830
UniProt: Q9MYJ8
Position
15:complement(21893472..21898687)
AA seq 355 aa
METSATTEDYDMITEFDYSDATPCHKANERAFGAKLLPPLYSLVFVIGLVGNILVVVVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWISYQLKTDWVFGNAMCKVLSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWVLAILASLPGLYFAKTQWEITH
RTCSLHFPHESRQEWKLFQALKLNLLGLVLPLLVMIVCYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTTLISVFQDFLFTYGCEQGRQLDLAIQVTEMIAYTHCCVNPVI
YAFVGERFRKHLRQLFHRRVAVHLVKWLPFLSVDRLERASSTSPSTGEHEVSAGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagacttcagccaccacagaggactatgacatgatcacagagtttgactactcggat
gcgactccgtgccataaagcgaacgagagggcttttggggccaagctgctgcccccgctg
tactccttggtatttgtcattggcctggttggcaacatcctggtggtcgtggtccttgtg
caatacaagaggctcaaaaatatgaccagcatctacctcttgaacctggccatttctgac
ctgctcttcctgttcacgctgcccttctggatcagctaccagttgaagactgactgggtt
ttcggtaatgccatgtgtaaggtcctctctgggttttattacacaggcttgtacagtgag
atctttttcatcattctgctgacgatcgacaggtacctagccatcgtccatgccgtgttt
gccttgcgggcacggactgtcactttcggtgtcatcaccagcatcatcatttgggtcctg
gccatcttggcttccctgccaggcttgtactttgccaagacccagtgggaaatcactcat
cgcacctgcagccttcatttccctcacgaaagccgacaagagtggaaactgtttcaggcg
ctgaaactgaacctcttggggctggtgttgcctttgttggtcatgatcgtctgctacaca
gggatcataaagattctgctcagacgaccaaatgagaagaaatccaaagctgtccgtctg
atttttgtcatcatgatcatcttctttctcttttggaccccctataatttgactacgctt
atttctgttttccaagacttcctgttcacctatgggtgtgagcagggcagacagctggac
ctggctattcaagtgacggagatgatcgcctacacgcactgctgtgtcaaccctgtgatc
tacgccttcgttggtgagaggttccggaagcatctgcggcagctcttccacaggcgtgtg
gccgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggccagc
tccacgtctccctccacaggggagcatgaagtctctgctgggttctga

DBGET integrated database retrieval system