KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398114
Entry
100398114         CDS       T03264                                 
Symbol
PCDH19
Name
(RefSeq) protocadherin 19
  KO
K16499  protocadherin delta 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cjc04515]
    100398114 (PCDH19)
Cell adhesion molecules [BR:cjc04515]
 Cadherins
  Protocadherins
   100398114 (PCDH19)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2
Other DBs
NCBI-GeneID: 100398114
NCBI-ProteinID: XP_002763118
Ensembl: ENSCJAG00000013461
UniProt: F6R608
Position
X:complement(89521790..89643901)
AA seq 1098 aa
MESLLLPVLLLLAVLWTQAAALINLKYSVEEEQRAGTVIANVAKDARDAGFALDPRQASA
FRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIK
DLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNEMFGLEIKT
RGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLNIKVTDSNDNNPVFGE
STYTVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTV
TGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSE
SAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYN
LTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDP
DLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGL
PSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKADDYDEGEN
GRVTYDMTEGDRGFFEIDQINGEVRTTRTFGDSSKSSYELIVVAHDHGKTSLSASALVLI
YLSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCRIAEY
SYGHQKKSSKKKKISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRR
SESTFMNVENQNTRANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLI
KSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHD
QNEGFHCREECRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEAAAADVEPYDDCGP
TKRTFATFGKDVSNHPAEERPTLKGKRTVDVTICSPKVNSVIREAGNGCEAISPVTSPLH
LKSPLPTKPSMSYTIALAPPARDLEQYVNNVNNGPSRPSEAEPRGADSEKVMHEVNPILK
EGRNKESPGVKRLKDIVL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggagtcgctcctgctgccggtgctgctgctgctggccgtactgtggacgcaggcagcc
gccctcattaacctcaagtactcggtggaagaggagcagcgtgccgggacggtgattgcc
aacgtggccaaggacgcgcgggatgcgggcttcgcgctggacccccggcaggcctcagcc
tttcgcgtggtgtccaactcggctccacacctagtggacatcaaccccagctctggcctc
ctggtcaccaagcagaagattgaccgtgacctgctgtgccgccagagccctaagtgcatc
atctcactcgaggtcatgtccagctcaatggaaatctgcgtgattaaggtagagatcaag
gacctgaacgacaatgcgcccagtttcccggcagcacagatcgagctggagatctcggag
gcagccagccctgggacacgcatcccgctggacagcgcctatgatccggactctggaagc
tttggcgtgcagacttacgagctcactcccaatgagatgttcggcctggagatcaagacg
cgtggcgacggctcgcgctttgccgaactggtagtggaaaagagcctggaccgcgagacg
cagtcgcactacagctttcgcatcactgcgctagacggtggcgacccgccacgcctgggc
accgttggcctcaacatcaaggtgaccgactccaatgacaacaacccggtgtttggcgag
tccacctacacggtgagcgtgccagaaaactcccctcccaacacacccgtcatccgcctc
aacgccagcgatccagacgagggcaccaacggccaggtggtctattccttctatggctac
gtcaacgaccgcacgcgcgagctctttcagattgacccgcacagtggcctggtcactgtc
actggcgctttagactatgaagagggccacgtgtatgaactggacgtgcaggccaaggac
ttagggcccaattccatcccggctcactgcaaggtcactgtcagcgtgctggacaccaat
gacaatccaccggtcatcaacctgctgtcagtcaacagcgagcttgtggaggtcagcgag
agcgcccccccgggctacgtgatcgccttggtgcgggtgtctgatcgcgactcgggcctc
aatggacgtgtacagtgccgtttgctgggcaatgtgccctttcgactgcaggaatatgag
agcttctccactattctagtggacggacggctggaccgcgagcagcacgaccaatacaac
ctcacaattcaggcacgcgacggcggcgtgcccatgctgcagagtgccaagtcctttacc
gtgctcatcactgatgaaaatgacaaccacccgcacttttctaagccctactaccaggtc
attgtgcaggagaacaacacacctggcgcctatctgctctctgtgtctgctcgcgacccc
gacctgggtctcaacggcagtgtctcctaccagatcgtgccgtcgcaggtgcgggacatg
cctgtcttcacctatgtctccatcaaccccaactcaggcgacatctacgcgctgcgatcc
tttaaccacgagcagaccaaggcgtttgaattcaaggtgctggccaaggacggcggcctc
ccctcactgcaaagcaacgcgacggtgcgggtcatcatcctcgacgtcaacgacaacacc
ccggtcatcacagccccacctctgattaacggcactgccgaggtctacataccccgcaac
tctggcataggctacctggtgactgttgtcaaggcagacgactacgatgagggcgaaaat
ggccgagtcacctacgacatgaccgagggcgaccgcggcttctttgaaatagaccagatc
aatggcgaagtcagaaccacccgcacctttggggatagctccaagtcctcctatgagctt
atcgtggtggcccacgaccacggcaagacatctctctctgcctctgctcttgtcctaatc
tacttgtcccctgctctcgatgcccaagagtcaatgggctctgtgaacttgtccttgatt
ttcattattgccctgggctccattgcgggcatcctctttgtaactatgatcttcgtggca
atcaagtgcaagcgagacaacaaagagatccggacctacaactgcagaatcgctgagtac
tcctatgggcatcaaaagaaatcaagcaagaagaaaaaaatcagtaagaatgacatccgt
ctggtaccccgggatgtggaggagacagacaagatgaacgttgtcagttgctcttccctg
acctcgtccctcaactattttgactaccaccagcagacactgcccctgggctgccgccgc
tctgagagcactttcatgaatgtggagaaccagaatacccgtgctaaccacatctaccat
cactctttcaacagccaggggccccagcagcctgacctgattatcaacggtgtgcctctg
cctgagactgaaaactattcttttgactccaactacgtgaatagccgagctcatttaatc
aaaagcagctccaccttcaaggacttagagggcaacagcctgaaggatagtggacatgag
gagagcgaccaaactgacagtgagcatgatgtccagcgaagcctgtattgtgatactgct
gtcaatgatgtgctgaacaccagtgtgacctccatgggatctcagatgcctgaccatgat
cagaatgagggatttcattgccgggaagaatgccggattcttggccactctgacaggtgc
tggatgccccggaatcccatgcccatccgttccaagtccccggagcatgtgaggaacatc
attgcgctgtccattgaagctgctgctgctgatgttgagccttatgacgactgcggcccc
actaaacggactttcgcaacctttggaaaagatgtcagcaaccacccggctgaggagagg
cccaccctgaaaggcaagaggactgtggatgtgaccatctgcagtcccaaggtcaacagc
gttatccgggaggcaggcaatggctgtgaggcgattagccctgtcacctccccgctccac
ctcaagagccctctacccaccaagccttccatgtcttacaccattgcgctggctccccca
gcccgtgatctggagcagtatgtcaacaatgtcaacaatggcccttctcgtccctctgaa
gctgagccccgtggagctgacagcgagaaagtcatgcatgaggtcaaccccattctgaag
gaaggtcgcaacaaagagtcccctggtgtgaagcgtctgaaggatatcgttctctaa

DBGET integrated database retrieval system