KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398268Help
Entry
100398268         CDS       T03264                                 

Gene name
RIPK3
Definition
(RefSeq) receptor interacting serine/threonine kinase 3
  KO
K08847  receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100398268 (RIPK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100398268 (RIPK3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100398268 (RIPK3)
   04623 Cytosolic DNA-sensing pathway
    100398268 (RIPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100398268 (RIPK3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100398268 (RIPK3)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   100398268 (RIPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RHIM APH TrbM Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100398268
NCBI-ProteinID: XP_003734021
Position
10
AA seq 551 aa AA seqDB search
MQTRSPLYQRPQPRKSLHLLQLAISSGPLVPSSLMSHVKLWLNGASASLVLDKXLENHKL
VGSGGFGNVFRAHHRKWGCDVAVKIVNSKAISREVKAMASLNNEFVLCLKGVIEEVGWDD
DFRPALVTEFMENGSLSGLLKPQCPRPWPLLCRLLKEVVLGMCYLHEQNPALLHQDLKPS
NILLDPELHVKLADFGLSTFQGSSPSGTGSREPGGTLGYLAPELFVNVNQKASPASDVYS
FGILMWAVLAGREAELPTEASLVYGAVCKREAQPSLNELSQAGPETPGLEGLKDLMQLCC
SNEPKDRPSFQECLPKTDEGFELVKNNMNAAVSTVKNFLSELRSSNRSGQGKTEMDGFGR
NTGRQHCYDDFMDSDLLNKLNLEDSSSCVPEKYPSLTKKSRAQEEQVPQARTAGTSSDSM
AQPPQTPETSTFRNQTPSPTSTGTPGPRPQRNQGAKRHGMNWSSRNLEPNPVTDTHSLPL
FFPPLPSSVWCSRGLFLTTHASQTTALPTQGLAPLGMGRGWQHPPLVGLQEGPKEPEAXS
EPQSGYNHSGK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcagacccgttcccctctctaccaaagaccgcagccccggaagtcactccatctcctg
cagctcgctatttccagcggccccctcgtaccttccagcctgatgtctcacgtcaagtta
tggttgaacggtgcttccgcctccttggtgttagacaagtaattggagaaccacaagctc
gtcggctcaggcgggttcggcaacgtgttccgggcgcatcataggaagtggggctgcgat
gtggctgtcaagatcgtgaactcgaaggcgatatccagggaggtcaaggccatggcaagt
ctgaataacgaattcgtgctgtgcctaaaaggggtcatcgaggaggtggggtgggacgac
gatttcaggccggcactggtgactgaattcatggagaacggctccctgtcggggctgctg
aagccccagtgccctcggccctggccactcctctgccgcctgctgaaagaagtggtgctc
gggatgtgttacctgcatgagcagaacccggcgctcctgcaccaggacctcaagccatcc
aacatcctgctggacccggagctgcacgtcaagctggcagattttggcctgtccacattt
cagggaagctcaccgtcagggacagggtctagggagccagggggcaccctgggctacttg
gccccagaactgtttgttaatgtaaaccagaaggcctccccagccagtgatgtctacagc
ttcgggatcctaatgtgggcagtgcttgctggaagagaagctgagttgccgaccgaagca
tcactggtgtatggagcagtgtgcaagagggaggcccagccctcactaaatgaactgtcc
caagctgggcctgagactcctggcttggaaggactgaaggatttaatgcagctctgctgt
agcaatgagcccaaggacagaccctccttccaggaatgcctaccaaaaaccgatgaaggc
ttcgagctggtgaagaacaatatgaatgctgctgtctccacagtaaagaatttcctgtct
gagctcaggagcagcaataggtcaggccaaggaaagacagaaatggatggctttgggaga
aacacaggaaggcagcactgttatgatgatttcatggattctgacctgctaaataaactg
aatctagaggattcttccagctgtgttcctgaaaaatacccaagtcttaccaagaagagc
agggcacaagaggagcaggttccacaagccaggacagcagggacatcttcagattcaatg
gctcaacctccccagactccagagacctcaactttcagaaaccagacacccagccccacc
tcaactggaacaccaggtcctagaccccaaaggaatcagggggctaagagacatggcatg
aactggtcctccaggaacctggaaccaaatccagtaacagatacccactctctacccctt
tttttccctccacttccttcctcagtttggtgttccagaggtttgtttctcaccactcat
gcttcacagacaactgccttgcccacccagggtctggcacctttgggcatgggcagaggc
tggcagcaccccccactagtaggtttgcaagaaggccctaaagaacctgaagcctagagt
gagccacagagtgggtataatcatagtgggaaataa

DBGET integrated database retrieval system