KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398414Help
Entry
100398414         CDS       T03264                                 

Gene name
ABL1
Definition
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04110  Cell cycle
cjc04360  Axon guidance
cjc04722  Neurotrophin signaling pathway
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05220  Chronic myeloid leukemia
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100398414 (ABL1)
   04012 ErbB signaling pathway
    100398414 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398414 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100398414 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100398414 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398414 (ABL1)
   05206 MicroRNAs in cancer
    100398414 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100398414 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100398414 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100398414 (ABL1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100398414 (ABL1)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  ABL family
   100398414 (ABL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 100398414
NCBI-ProteinID: XP_002743448
Ensembl: ENSCJAG00000020525
UniProt: U3BH45
Position
1
AA seq 1149 aa AA seqDB search
MGQQPGKVLGDQRRPSLPALHFIKGAGRKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGIRGAAST
LLQAPELPTKTRTSRRAAEHRDAADVPEVHHSKGQGESDPLDHELAVSPLLPRKERGPPE
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDI
SNGALALTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATG
EEDGGSSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRAGENRPDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPSLTPKLLRRQ
AMMAPASGLPNKEEAGKGGALGTPAVAEPVPPTSKAGSGVPAGTSKGPTEESRVRRHKHS
SESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAGLGAKTKATSLADAV
NSDAAKPSQLGEGFKKPVLPATPKPQSTKPSGTPVSPAPIPSTLPSASSALAGDQPSSTA
FIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGK
NLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSV
KEISDIVQR
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagtttgcctgccctg
cattttatcaaaggagcagggaggaaggagtcctcgaggcatgggggcccacactgtaat
gtttttgtggaacatgaagcccttcagaggccagtagcatcggactttgagcctcagggt
ctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaaaat
gaccccaacctttttgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgtgtcttaggctataatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaaggctgggtgccaagcaactacatcacgccagtcaacagt
ctggagaagcactcctggtaccatggacctgtgtcccgcaatgccgctgaatatctgctg
agcagtgggatcaatggcagcttcttggtgcgggaaagtgagagcagtcctggccagagg
tccatctcactgagatacgaagggagggtgtaccattacaggatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcatcat
cactcaacagtggccgacgggctcatcaccacgctccattatccggcccccaagcgcaac
aagcccactgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcaccgac
atcaccatgaagcacaagctgggcgggggccagtatggggaggtgtatgagggcgtgtgg
aagaagtacagtctgacagtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtccagctc
cttggggtctgtacccgggagcccccgttctatatcatcaccgagtttatgacctatggg
aacctgctggactacctgagggagtgcaaccggcaggaggtgaatgccgtggtgctgctg
tacatggccactcagatctcatcagccatggagtacctggagaagaagaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtggcagat
tttggcctgagcaggttgatgacaggggacacctacactgcccatgccggagccaaattc
ccaatcaaatggactgcacctgagagcctggcctacaacaagttctccatcaagtctgat
gtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttaccca
ggaattgacctgtcccaggtgtatgagctgctggagaaggattaccgcatggagcgccca
gaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatccagt
atctctgatgaagtggaaaaggagctggggaaacaaggcatccgtggggctgcgagcacc
ttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcggagcac
agagacgccgccgacgtgcctgaggtgcatcactccaagggccagggagagagtgatcct
ctggaccacgagcttgccgtgtctccattgctccctcgaaaagagcgaggtcccccagag
ggtggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagc
gccttgatcaagaagaagaagaagacagcaccaacaccccccaaacgcagcagttccttc
cgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgggacatc
agcaacggggcgctggctcttacccccttggacacagctgacccagccaagtccccaaag
cctagcaacggggctggggtccccaacggagccctccgggagtctgggggctcaggcttc
cgctctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccactgga
gaggaggatggcggcagcagctccagcaagcgcttcctgcgctcctgctccgcctcctgc
gtgccccatggggccaaggacacagagtggaggtcagtcacactgcctcgggacttgcag
tccactggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccggct
ctgcctcggaagagggcaggggagaacaggcctgaccaggtgacccgaggcacagtgacg
cccccacccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagacatc
atggagtctagcccaggctccagcccgcccagcctgactccaaaactcctccgtcggcag
gccatgatggcccctgcctcgggcctccccaacaaggaagaagctgggaagggcggtgcc
ttagggacccctgctgtagctgagccagtgccccccaccagcaaagcgggctcaggtgta
ccagcaggcaccagcaagggtcccaccgaggagtccagagtgaggaggcacaagcactcc
tctgagtcaccaggcagggacaaggggaaattgtccaggctcaaacctgccccgccgccc
ccaccagcagcctctgcagggaaggctggaggaaagccctcacagagcccgagccaggag
gcggccggggaggcaggcctgggagcaaagacaaaagccacaagtctggctgatgctgtg
aacagtgacgctgccaagcccagccagctgggagagggcttcaaaaagccagtactccca
gccactccaaagccacagtccaccaagccatcggggacccccgtcagcccagcccccatt
ccctccacgttgccatcagcatcctcggccctggctggggaccagccatcttccactgcc
ttcatccctctcatatcaacccgcgtgtctcttcggaaaacccgccagcctccagagcgg
atcgccagcggcaccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgcctc
gccatctctaggaactctgagcagatggccagccacagcgcggtcctggaggccggcaaa
aacctctacacgttctgcgtgagctacgtggattccatccagcaaatgaggaacaagttt
gccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgcccg
gcgacagcaggcagtggtccggcagccactcaggacttcagcaagctcctcagttcagtg
aaggaaatcagcgacatagtgcagaggtag

DBGET integrated database retrieval system